The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDVE8",
"status": "Published",
"type_of_curve": "SEC-SAS",
"angular_unit": "1/A",
"project": {
"title": "Unraveling the molecular grammar and the structural transitions underlying the fibrillation of a viral fibrillogenic domain.",
"publication": {
"title": "Unraveling the molecular grammar and the structural transitions underlying the fibrillation of a viral fibrillogenic domain.",
"author_list": "Gondelaud F, Leval J, Arora L, Walimbe A, Bignon C, Ptchelkine D, Brocca S, Mukhopadyay S, Longhi S",
"journal": "Protein Sci",
"doi": "10.1002/pro.70068",
"pmid": "39985377",
"published_date": "2025 Mar"
},
"status": "released",
"submitted_date": "2024-10-14",
"released_date": "2025-02-24"
},
"pddf_data": null,
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDVE8.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDVE8_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDVE8_kratky_img.png",
"pddf_plot": null,
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDVE8_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDVE8.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Eiger 4M",
"resolution": 75.0
},
"name": "SOLEIL",
"city": "Saint-Aubin",
"country": "France",
"beamline_name": "SWING",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Protein W (artificial PNT3 variant - high-kappa)",
"short_name": "PNT3 high K",
"sequence": "MSYYHHHHHHLESTSLYKKAGFTPTEEPPVIPEYYYGSGDDGDLSESPPEGNVNLDSIEIYTSDDEDENQLEYEDEFAESSSEVVIDTTPEDNDSINQEEVVGDPSDQGLKHPFPLGKFPKKKRTPRVRRKRS",
"organism": "Hendra virus (isolate Horse/Autralia/Hendra/1994)",
"uniprot_code": "P0C1C6",
"uniprot_range_first": 200,
"uniprot_range_last": 310,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MDKLDLVNDGLDIIDFIQKNQKEIQKTYGRSSIQQPSTKDRTRAWEDFLQSTSGEHEQAE\r\nGGMPKNDGGTEGRNVEDLSSVTSSDGTIGQRVSNTRAWAEDPDDIQLDPMVTDVVYHDHG\r\nGECTGHGPSSSPERGWSYHMSGTHDGNVRAVPDTKVLPNAPKTTVPEEVREIDLIGLEDK\r\nFASAGLNPAAVPFVPKNQSTPTEEPPVIPEYYYGSGRRGDLSKSPPRGNVNLDSIKIYTS\r\nDDEDENQLEYEDEFAKSSSEVVIDTTPEDNDSINQEEVVGDPSDQGLEHPFPLGKFPEKE\r\nETPDVRRKDSLMQDSCKRGGVPKRLPMLSEEFECSGSDDPIIQELEREGSHPGGSLRLRE\r\nPPQSSGNSRNQPDRQLKTGDAASPGGVQRPGTPMPKSRIMPIKKGAQTRSLNMLGRKTCL\r\nGRRVVQPGMFADYPPTKKARVLLRRMSN",
"mw": 15.198,
"total_mw": 15.198,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": "Artificial variant of PNT3 with a segregated distribution of the opposite charges (High kappa). The protein construct used for SAXS contains a non-native polyhistitine tag and additional amino acids (MSYYHHHHHHLESTSLYKKAGF)."
}
],
"buffer": {
"name": "20 mM HEPES, 150 mM NaCl",
"concentration_unit": null,
"comment": "HBS",
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.2,
"deuteration": null
},
"purity_method": null,
"name": "Hendra virus protein P/V/W PNT3 high-K domain",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "13288 Marseille, France",
"full_name": "CNRS, AFMB UMR 7257 ",
"webpage": ""
}
],
"contributor_name": "Frank",
"contributor_surname": "Gondelaud",
"orcid": ""
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2024-04-05",
"storage_temperature": 4.0,
"cell_temperature": 20.0,
"exposure_time": 0.99,
"number_of_frames": 600,
"wavelength": 0.133,
"sample_detector_distance": 2.0,
"concentration_min": null,
"concentration_max": 5.0,
"sample_volume": 50.0,
"flow_rate": 0.3,
"s_min": 0.089,
"s_max": 4.689,
"total_exposure_time": null,
"seccolumn": 10
},
"fits": [
{
"models": [],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDVE8_fit1_fixed_fit_img.png",
"software": "EOM/GAJOE",
"chi_square_value": 1.006,
"p_value": 0.1946,
"fit_residual_plot": "SASDVE8_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDVE8_fit1.fit",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/logFile_001_1_nHnJcis.log",
"software_version": null,
"description": "EOM online was used."
}
],
"estimated_volume_method": null,
"pddf_software": null,
"pddf_software_version": null,
"i0_calibration_standard": null,
"description": "50 µl were injected on a BioSec 3-300 at 0.3 ml/min in HBS",
"experiment_description": "Synchrotron SAXS data from solutions of Hendra virus protein P/V/W PNT3 high-K domain in 20 mM HEPES, 150 mM NaCl, pH 7.2 were collected on the SWING beam line at SOLEIL (Saint-Aubin, France) using a Eiger 4M detector at a sample-detector distance of 2 m and at a wavelength of λ = 0.133 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). In-line size-exclusion chromatography (SEC) SAS was employed. The SEC parameters were as follows: A 50.00 μl sample at 5 mg/ml was injected at a 0.30 ml/min flow rate onto a Agilent Bio SEC-3, 300 Å column at 20°C. 600 successive 0.990 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 23.3,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 33.6,
"porod_mw_error": null,
"pddf_i0": null,
"pddf_i0_error": null,
"guinier_i0": 1.10416,
"guinier_i0_error": null,
"pddf_rg": null,
"pddf_rg_error": null,
"guinier_rg": 3.126,
"guinier_rg_error": 0.151,
"pddf_dmax": 14.7,
"pddf_dmax_error": null,
"porod_volume": 53.8,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 1,
"guinier_point_last": 51,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDVE8_datloglog_img.png",
"symmetry": null,
"last_modified": "2025-02-24T10:52:45.703208+01:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDVE8",
"status": "success",
"started_at": "2026-08-11T15:51:57.907250+00:00",
"finished_at": "2026-08-11T15:52:03.421586+00:00",
"source_last_modified": "2025-02-24T10:52:45.703208+01:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDVE8/",
"path": "/data/saxsdb/sasbdb/entries/e8/sasdve8/source/summary.json",
"size": 7382,
"sha256": "d18df0feab36f63018d72ef8bff23941b6914db18fbd3be7c429cad6856c126d"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDVE8.dat",
"path": "/data/saxsdb/sasbdb/entries/e8/sasdve8/source/SASDVE8.dat",
"size": 38178,
"sha256": "326dd080ac83b216f52b90d39565b1fc80a5e8c23fe0de035278cc4ee7f5c4a9",
"role": "curve"
},
{
"role": "pddf",
"status": "not_listed",
"path": "/data/saxsdb/sasbdb/entries/e8/sasdve8/source/SASDVE8.out"
},
{
"status": "not_available",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDVE8.sascif",
"path": "/data/saxsdb/sasbdb/entries/e8/sasdve8/source/SASDVE8.sascif",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDVE8.zip",
"path": "/data/saxsdb/sasbdb/entries/e8/sasdve8/source/SASDVE8.zip",
"size": 28135,
"sha256": "626c2e7cb8e55f754e4097abe30cc735a84ecca4b4a85ccca26f2053107673d9",
"role": "full_entry_zip",
"zip_member_count": 3,
"zip_validation": "central_directory_readable"
}
]
}
