The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDVH4",
"status": "Published",
"type_of_curve": "SEC-SAS",
"angular_unit": "1/nm",
"project": {
"title": "Anemia-associated mutations disrupt the CDIN1-Codanin1 complex in inherited congenital dyserythropoietic anemia I (CDA-I) disease.",
"publication": {
"title": "Anemia-associated mutations disrupt the CDIN1-Codanin1 complex in inherited congenital dyserythropoietic anemia I (CDA-I) disease.",
"author_list": "Stojaspal M, Brom T, Nečasová I, Janovič T, Veverka P, Verma N, Uhrík L, Hernychova L, Hofr C",
"journal": "FEBS J",
"doi": "10.1111/febs.70421",
"pmid": "41609415",
"published_date": "2026 Jan 29"
},
"status": "released",
"submitted_date": "2024-07-10",
"released_date": "2026-02-02"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDVH4.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDVH4.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDVH4_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDVH4_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDVH4_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDVH4_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDVH4.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus 6M",
"resolution": null
},
"name": "PETRA III",
"city": "DESY; Hamburg",
"country": "Germany",
"beamline_name": "EMBL P12",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Codanin-1",
"short_name": "Codanin1",
"sequence": "SGAARGERRGCSRACEHHAPLPSHLISEIKDVLSLAVGPRDPDEGVSPEHLEQLLGQLGQTLRCRQFLCPPAEQHLAKCSVELASLLVADQIPILGPPAQYRLERGQARRLLHMLLSLWKEDFQGPVPLQLLLSPRNVGLLADTRPREWDLLLFLLRELVEKGLMGRMEIEACLGSLHQAQWPGDFAEELATLSNLFLAEPHLPEPQLRACELVQPNRGTVLAQS",
"organism": "Homo sapiens",
"uniprot_code": "Q8IWY9",
"uniprot_range_first": 1005,
"uniprot_range_last": 1227,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MAAVLESLLREEVSVAAVVRWIARSTQGSEDNAGEAAALSSLRALRKEFVPFLLNFLREQ\nSSRVLPQGPPTPAKTPGASAALPGRPGGPPRGSRGARSQLFPPTEAQSTAAEAPLARRGG\nRRRGPGPARERGGRGLEEGVSGESLPGAGGRRLRGSGSPSRPSLTLSDPPNLSNLEEFPP\nVGSVPPGPTGTKPSRRINPTPVSEERSLSKPKTCFTSPPISCVPSSQPSALDTSPWGLGL\nPPGCRSLQEEREMLRKERSKQLQQSPTPTCPTPELGSPLPSRTGSLTDEPADPARVSSRQ\nRLELVALVYSSCIAENLVPNLFLELFFVFQLLTARRMVTAKDSDPELSPAVLDSLESPLF\nQSIHDCVFFAVQVLECHFQVLSNLDKGTLKLLAENERLLCFSPALQGRLRAAYEGSVAKV\nSLVMPPSTQAVSFQPETDNRANFSSDRAFHTFKKQRDVFYEVLREWEDHHEEPGWDFEKG\nLGSRIRAMMGQLSAACSHSHFVRLFQKQLLQMCQSPGGAGGTVLGEAPDVLSMLGADKLG\nRLWRLQERLMAPQSSGGPCPPPTFPGCQGFFRDFILSASSFQFNQHLMDSLSLKIQELNG\nLALPQHEPNDEDGESDVDWQGERKQFAVVLLSLRLLAKFLGFVAFLPYRGPEPPPTGELQ\nDSILALRSQVPPVLDVRTLLQRGLQARRAVLTVPWLVEFLSFADHVVPLLEYYRDIFTLL\nLRLHRSLVLSQESEGKMCFLNKLLLLAVLGWLFQIPTVPEDLFFLEEGPSYAFEVDTVAP\nEHGLDNAPVVDQQLLYTCCPYIGELRKLLASWVSGSSGRSGGFMRKITPTTTTSLGAQPS\nQTSQGLQAQLAQAFFHNQPPSLRRTVEFVAERIGSNCVKHIKATLVADLVRQAESLLQEQ\nLVTQGEEGGDPAQLLEILCSQLCPHGAQALALGREFCQRKSPGAVRALLPEETPAAVLSS\nAENIAVGLATEKACAWLSANITALIRREVKAAVSRTLRAQGPEPAARGERRGCSRACEHH\nAPLPSHLISEIKDVLSLAVGPRDPDEGVSPEHLEQLLGQLGQTLRCRQFLCPPAEQHLAK\nCSVELASLLVADQIPILGPPAQYRLERGQARRLLHMLLSLWKEDFQGPVPLQLLLSPRNV\nGLLADTRPREWDLLLFLLRELVEKGLMGRMEIEACLGSLHQAQWPGDFAEELATLSNLFL\nAEPHLPEPQLRACELVQPNRGTVLAQS",
"mw": 24.961,
"total_mw": 24.961,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": "The protein construct used for SAXS spans the C-terminal domain, with an additional two non-native amino acids at the N-terminus of the construct (SG)."
}
],
"buffer": {
"name": "20 mM Tris HCl, 150 mM NaCl, 5% glycerol",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 8.0,
"deuteration": null
},
"purity_method": null,
"name": "Human Codanin1 C-terminal domain (frames 779 - 791)",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": null,
"full_name": "National Centre for Biomolecular Research, Faculty of Science, Masaryk University",
"webpage": null
}
],
"contributor_name": "Tomas",
"contributor_surname": "Brom",
"orcid": "https://orcid.org/0000-0003-1046-192X"
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2023-09-29",
"storage_temperature": 4.0,
"cell_temperature": 20.0,
"exposure_time": 0.495,
"number_of_frames": 1200,
"wavelength": 0.123982,
"sample_detector_distance": 3.0,
"concentration_min": null,
"concentration_max": 10.0,
"sample_volume": 45.0,
"flow_rate": 0.3,
"s_min": 0.026,
"s_max": 4.434,
"total_exposure_time": null,
"seccolumn": 2
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDVH4_fit1_model1_img.png",
"software": "AlphaFold",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": "2.0",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDVH4_fit1_model1.pdb",
"model_mw": 24.94,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": null,
"user": 720
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDVH4_fit1_fixed_fit_img.png",
"software": "CRYSOL",
"chi_square_value": 2.004,
"p_value": 0.0,
"fit_residual_plot": "SASDVH4_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDVH4_fit1.fit",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/best_6bsec_Codanin1_Cterm_secondP_cut_Codanin1_Cterm_monomer_long.log",
"software_version": "3.2.1",
"description": ""
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDVH4_fit2_model1_img.png",
"software": "AlphaFold",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": "2.0",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDVH4_fit2_model1.pdb",
"model_mw": 49.87,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": null,
"user": 720
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDVH4_fit2_fixed_fit_img.png",
"software": "CRYSOL",
"chi_square_value": 40.116,
"p_value": 0.0,
"fit_residual_plot": "SASDVH4_fit2_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDVH4_fit2.fit",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/best_6bsec_Codanin1_Cterm_secondP_cut_Codanin1_Cterm_dimer_long.log",
"software_version": "3.2.1",
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": null,
"experiment_description": "The SEC-SAXS data from the solution of Codanin1 Cterm diluted in 20 mM Tris HCl, 150 mM NaCl, 5% glycerol, pH 8.0 buffer were collected on the EMBL P12 beamline at the PETRA III storage ring (DESY; Hamburg, Germany) using a Pilatus 6M detector at a sample-detector distance of 3 m and at a wavelength of λ = 0.123982 nm. In-line size-exclusion chromatography (SEC) SAXS was employed. The sample (45 μl at 10 mg/ml) was injected and ran into a GE Superdex 200 Increase 5/150 column at a flow rate of 0.3 ml/min at 20°C. Scattering data were collected throughout the entire SEC column elution with an exposure time of 0.495 sec/frame (for 1200 frames total). The data were normalized to the intensity of the transmitted beam. The selected area of sample elution peak was selected and processed (averaged and buffer subtracted) from 13 data frames using CHROMIXS and primusqt from the ATSAS 3.2.1 package. The radius of gyration (Rg), forward scattering (I(0)), maximum particle dimension (Dmax), and the distance distribution function were determined using primusqt and GNOM. The calculated molecular weight (MW) of Codanin1 Cterm is around 25 kDa. MALDI-TOF mass spectrometry suggests a MW 24 965 Da for the Codanin1 Cterm monomer. The MW estimation from the SAXS data (primusqt) varied depending on the method used: Qp = 30.1 kDa, MoW = 30.8 kDa, Vc = 30.6 kDa, Size & Shape = 35.7 kDa (Bayesian Inference MW, 31.7 kDa in the 93% credibility interval of 29.3-32.8 kDa). The models displayed in this entry included: Top: The Alphafold2 predicted model of Codanin1 Cterm monomer compared with the SAXS data using CRYSOL. Bottom: The Alphafold2 predicted model of Codanin1 Cterm dimer compared with the SAXS data using CRYSOL.",
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 30.0,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 30.1,
"porod_mw_error": null,
"pddf_i0": 3682.0,
"pddf_i0_error": 4.71,
"guinier_i0": 3670.74,
"guinier_i0_error": null,
"pddf_rg": 2.581,
"pddf_rg_error": 0.01,
"guinier_rg": 2.512,
"guinier_rg_error": 0.005,
"pddf_dmax": 9.3,
"pddf_dmax_error": null,
"porod_volume": 51.4,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 15,
"guinier_point_last": 168,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDVH4_datloglog_img.png",
"symmetry": null,
"last_modified": "2026-02-02T14:39:37.018334+01:00",
"bragg_peak": []
}
