The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDVK8",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/A",
"project": {
"title": "Structural and functional characterization of S9 peptidase form Rhizobium radiobacter",
"publication": null,
"status": "released",
"submitted_date": "2024-10-14",
"released_date": "2025-10-14"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDVK8.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDVK8.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDVK8_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDVK8_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDVK8_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDVK8_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDVK8.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "MAR 345 Image Plate",
"resolution": null
},
"name": "INDUS-2",
"city": "Indore",
"country": "India",
"beamline_name": "BL-18",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "S9 peptidase form Rhizobium radiobacter",
"short_name": "S9rr",
"sequence": "MASWSHPQFEKGSSHHHHHHSSGSGGGGGENLYFQGSTATDLIPIETLFGMPEFSRAHISPDGRLVAYLAPWRGRLNIWVRPLGQGAARRLTADDTRNIDGFSWTRDARYILFVQDTQGDENWHLHRVEVDGAETVGGKARTVDLTPYSGVRVMGLDLSAAFPGKAFVQMNLRSPGLIDLYEVDIESAETRVAALNPGRFVRWIVTPNGPMHAFIINDAGDHELARYENGVFTTLANLSGRDQPIGPMPLMVAADGKSVLVGCNAGSDHTYLAAIDLATGKHRVVDSQPDYSLDTPRPEADPRFPSSLISNPVTGELLGLRYLGKRQQIRPLNPHFAAVLDSLQRLSDGEIGYISCDADGRQWVAEIWDDRHPGTTWFYEHESGEAYVLGERFSQLSAERLASVRPIDVMSRDGLTLPCHVTLPIGFDAKDEPRALPTVLLVHGGPWYRDACFYDPEVQFLANRGYAVLQVNFRGSTGYGKAFMQAAIGEFSGRMHDDLIDGLDWLIRQGIADPARVAIYGCSYGGYAALVGASFTPERFAATISYSGMSDLRLLVDGVVSFIRPALINTYLSYMGDPDIETQARDMLARSPASRLDCISKPLLVVHGANDVRVAKAQADLVVERVRANGVEVDYLLNDREGHWFINEDSNIELYRKIERFLARHLRGE",
"organism": "Agrobacterium radiobacter",
"uniprot_code": null,
"uniprot_range_first": 2,
"uniprot_range_last": 633,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "",
"mw": 73.901,
"total_mw": 73.901,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": "The S9 peptidase of Rhizobium radiobacter (S9rr; WP_077998848.1) was cloned and recombinantly expressed in E. coli. The recombinant S9rr protein was purified to homogeneity using Ni-IMAC, followed by size exclusion chromatography (SEC). Both SEC and dynamic light scattering confirmed monomeric quaternary state and monodispersity. \r\nThe protein construct used for SAXS contains additional N-terminal non native amino acids, including a polyhistidine tag (MASWSHPQFEKGSSHHHHHHSSGSGGGGGENLYFQGS). NCBI Reference Sequence: WP_077998848.1 (https://www.ncbi.nlm.nih.gov/protein/WP_077998848.1)."
}
],
"buffer": {
"name": "10 mM Tris-HCl, 135 mM NaCl",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 8.0,
"deuteration": null
},
"purity_method": null,
"name": "S9 peptidase form Rhizobium radiobacter (4mg/ml)",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "Mumbai 400085, INDIA",
"full_name": "Bhabha Atomic Research Centre",
"webpage": null
}
],
"contributor_name": "Dr. Rahul",
"contributor_surname": "Singh",
"orcid": "https://orcid.org/0000-0003-4871-3600"
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2024-03-21",
"storage_temperature": 21.0,
"cell_temperature": 21.0,
"exposure_time": null,
"number_of_frames": null,
"wavelength": 0.1033,
"sample_detector_distance": 2.2,
"concentration_min": null,
"concentration_max": 6.0,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.237,
"s_max": 2.619,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDVK8_fit1_model1_img.png",
"software": "DAMMIN",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDVK8_fit1_model1.cif",
"model_mw": null,
"bead_radius": null,
"log": "https://www.sasbdb.org/media/log_files/4_S9rr_1.log",
"symmetry": null,
"comment": null,
"user": 649
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDVK8_fit1_fixed_fit_img.png",
"software": "DAMMIN",
"chi_square_value": 1.147,
"p_value": 0.0001,
"fit_residual_plot": "SASDVK8_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDVK8_fit1.fir",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/4_S9rr_1.log",
"software_version": null,
"description": ""
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDVK8_fit2_model1_img.png",
"software": "AlphaFold",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": "AlphaFold 3",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDVK8_fit2_model1.pdb",
"model_mw": 73.88,
"bead_radius": null,
"log": "https://www.sasbdb.org/media/log_files/Cut_S9RR_4mg-Ang_fold_s9rr_monomer_model_1.log",
"symmetry": null,
"comment": null,
"user": 649
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDVK8_fit2_fixed_fit_img.png",
"software": "CRYSOL",
"chi_square_value": 4.483,
"p_value": 0.0,
"fit_residual_plot": "SASDVK8_fit2_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDVK8_fit2.fit",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/Cut_S9RR_4mg-Ang_fold_s9rr_monomer_model_1.log",
"software_version": "ATSAS 3.3.0 (r14945)",
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": "Likely aggregated. Likely over-subtraction of background scattering contributions. X-ray Exposure time = UNKNOWN. Number of frames = UNKNOWN. NCBI Reference Sequence: WP_077998848.1 (https://www.ncbi.nlm.nih.gov/protein/WP_077998848.1).",
"experiment_description": "Synchrotron SAXS data from solutions of S9 peptidase form Rhizobium radiobacter in 10 mM Tris-HCl, 135 mM NaCl, pH 8 were collected on the BL-18 beam line at INDUS-2 (Indore, India) using a MAR 345 Image Plate detector at a sample-detector distance of 2.2 m and at a wavelength of λ = 0.1033 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). One solute concentration of 6.00 mg/ml was measured at 21°C. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 124.45,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 80.0,
"porod_mw_error": null,
"pddf_i0": 1.149,
"pddf_i0_error": null,
"guinier_i0": 1.51413,
"guinier_i0_error": null,
"pddf_rg": 2.99,
"pddf_rg_error": null,
"guinier_rg": 3.632,
"guinier_rg_error": 1.188,
"pddf_dmax": 9.5,
"pddf_dmax_error": null,
"porod_volume": 128.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 8,
"guinier_point_last": 26,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDVK8_datloglog_img.png",
"symmetry": null,
"last_modified": "2025-10-21T13:32:44.478389+02:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDVK8",
"status": "success",
"started_at": "2026-08-11T15:55:26.374099+00:00",
"finished_at": "2026-08-11T15:55:34.022890+00:00",
"source_last_modified": "2025-10-21T13:32:44.478389+02:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDVK8/",
"path": "/data/saxsdb/sasbdb/entries/k8/sasdvk8/source/summary.json",
"size": 9286,
"sha256": "fd908383d9b42033f92f4362020059c6d3ece30dce2dfd4aee9ea3975ebc0db7"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDVK8.dat",
"path": "/data/saxsdb/sasbdb/entries/k8/sasdvk8/source/SASDVK8.dat",
"size": 31347,
"sha256": "ac64091d256fe5178ff8bdbf30df1c16fa6c3b1a511a2c7bd0b6f95ceb2d4cab",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDVK8.out",
"path": "/data/saxsdb/sasbdb/entries/k8/sasdvk8/source/SASDVK8.out",
"size": 48537,
"sha256": "b8b6b75635e4081e9cfe3f29cc1bda410e304015424e70d5ff0fe6d7241ecc5f",
"role": "pddf"
},
{
"status": "not_available",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDVK8.sascif",
"path": "/data/saxsdb/sasbdb/entries/k8/sasdvk8/source/SASDVK8.sascif",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDVK8.zip",
"path": "/data/saxsdb/sasbdb/entries/k8/sasdvk8/source/SASDVK8.zip",
"size": 162721,
"sha256": "90c8bbbd9dad38a9477ae9b0ed6a92a4ce41ca6d125abc9cb8cea72d8693e0f8",
"role": "full_entry_zip",
"zip_member_count": 6,
"zip_validation": "central_directory_readable"
}
]
}
