PABL2 (Partner and localizer of BRCA2) incubated with dT50 (DNA)

{
  "code": "SASDVR7",
  "status": "Published",
  "type_of_curve": "Single concentration",
  "angular_unit": "1/A",
  "project": {
    "title": "The strand exchange domain of tumor suppressor PALB2 is intrinsically disordered and promotes oligomerization-dependent DNA compaction.",
    "publication": {
      "title": "The strand exchange domain of tumor suppressor PALB2 is intrinsically disordered and promotes oligomerization-dependent DNA compaction.",
      "author_list": "Kyriukha Y, Watkins MB, Redington JM, Chintalapati N, Ganti A, Dastvan R, Uversky VN, Hopkins JB, Pozzi N, Korolev S",
      "journal": "iScience",
      "doi": "10.1016/j.isci.2024.111259",
      "pmid": "39584160",
      "published_date": "2024 Dec 20"
    },
    "status": "released",
    "submitted_date": "2024-10-05",
    "released_date": "2024-12-23"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDVR7.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDVR7.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDVR7_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDVR7_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDVR7_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDVR7_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDVR7.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": null,
        "name": "Eiger 4M",
        "resolution": 75.0
      },
      "name": "Cornell High Energy Synchrotron Source (CHESS)",
      "city": "Ithaca, NY",
      "country": "USA",
      "beamline_name": "ID7A1 BioSAXS / HP-Bio Beamline",
      "beam_geometry": null,
      "type_of_source": "X-ray synchrotron",
      "point_source": true,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Partner and localizer of BRCA2",
          "short_name": "PALB2",
          "sequence": "MDEPPGKPLSCEEKEKLKEKLAFLKREYSKTLARLQRAQRAEKIKHSIKKTVEEQDCLSQ\r\nQDLSPQLKHSEPKNKICVYDKLHIKTHLDEETGEKTSITLDVGPESFNPGDGPGGLPIQR\r\nTDDTQEHFPHRVSDPSGEQKQKLPSRRKKQQKRTFISQERDCVFGTDSLRLSGKRLKEQE\r\nEISSKNPARSPVTEIRTHLL",
          "organism": "Homo sapiens",
          "uniprot_code": "Q86YC2",
          "uniprot_range_first": 1,
          "uniprot_range_last": 200,
          "oligomerization": "dimer",
          "molecular_type": "protein",
          "uniprot_sequence": "MDEPPGKPLSCEEKEKLKEKLAFLKREYSKTLARLQRAQRAEKIKHSIKKTVEEQDCLSQ\nQDLSPQLKHSEPKNKICVYDKLHIKTHLDEETGEKTSITLDVGPESFNPGDGPGGLPIQR\nTDDTQEHFPHRVSDPSGEQKQKLPSRRKKQQKRTFISQERDCVFGTDSLRLSGKRLKEQE\nEISSKNPARSPVTEIRTHLLSLKSELPDSPEPVTEINEDSVLIPPTAQPEKGVDTFLRRP\nNFTRATTVPLQTLSDSGSSQHLEHIPPKGSSELTTHDLKNIRFTSPVSLEAQGKKMTVST\nDNLLVNKAISKSGQLPTSSNLEANISCSLNELTYNNLPANENQNLKEQNQTEKSLKSPSD\nTLDGRNENLQESEILSQPKSLSLEATSPLSAEKHSCTVPEGLLFPAEYYVRTTRSMSNCQ\nRKVAVEAVIQSHLDVKKKGFKNKNKDASKNLNLSNEETDQSEIRMSGTCTGQPSSRTSQK\nLLSLTKVSSPAGPTEDNDLSRKAVAQAPGRRYTGKRKSACTPASDHCEPLLPTSSLSIVN\nRSKEEVTSHKYQHEKLFIQVKGKKSRHQKEDSLSWSNSAYLSLDDDAFTAPFHRDGMLSL\nKQLLSFLSITDFQLPDEDFGPLKLEKVKSCSEKPVEPFESKMFGERHLKEGSCIFPEELS\nPKRMDTEMEDLEEDLIVLPGKSHPKRPNSQSQHTKTGLSSSILLYTPLNTVAPDDNDRPT\nTDMCSPAFPILGTTPAFGPQGSYEKASTEVAGRTCCTPQLAHLKDSVCLASDTKQFDSSG\nSPAKPHTTLQVSGRQGQPTCDCDSVPPGTPPPIESFTFKENQLCRNTCQELHKHSVEQTE\nTAELPASDSINPGNLQLVSELKNPSGSCSVDVSAMFWERAGCKEPCIITACEDVVSLWKA\nLDAWQWEKLYTWHFAEVPVLQIVPVPDVYNLVCVALGNLEIREIRALFCSSDDESEKQVL\nLKSGNIKAVLGLTKRRLVSSSGTLSDQQVEVMTFAEDGGGKENQFLMPPEETILTFAEVQ\nGMQEALLGTTIMNNIVIWNLKTGQLLKKMHIDDSYQASVCHKAYSEMGLLFIVLSHPCAK\nESESLRSPVFQLIVINPKTTLSVGVMLYCLPPGQAGRFLEGDVKDHCAAAILTSGTIAIW\nDLLLGQCTALLPPVSDQHWSFVKWSGTDSHLLAGQKDGNIFVYHYS",
          "mw": 22.946,
          "total_mw": 45.892,
          "number_molecules": 2,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": "DNA binding domain of the human truncated partner and localizer of BRCA2 (PALB2)"
        }
      ],
      "buffer": {
        "name": "20 mM HEPES, 160 mM NaCl, 0.5 mM TCEP pH 7.5",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 7.5,
        "deuteration": null
      },
      "purity_method": null,
      "name": "PABL2 (Partner and localizer of BRCA2) incubated with dT50 (DNA)",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": null,
            "full_name": "Illinois Institute of Technology",
            "webpage": null
          }
        ],
        "contributor_name": "Maxwell",
        "contributor_surname": "Watkins",
        "orcid": "https://orcid.org/0000-0003-4559-2049"
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2023-12-09",
    "storage_temperature": -20.0,
    "cell_temperature": 23.0,
    "exposure_time": 1.0,
    "number_of_frames": 2632,
    "wavelength": 0.1097,
    "sample_detector_distance": 1.78,
    "concentration_min": null,
    "concentration_max": 3.7,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.083,
    "s_max": 4.432,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "5.0",
  "i0_calibration_standard": null,
  "description": "EFA-separated main component profile from SEC-SAXS measurement of PABL2 incubated with dT50 (2:1 ratio protein:DNA). NOTE: There is a significant inconsistency between the calculated MW from sequence of the monomer (23 kDa) and the quoted experimental MW (50 kDa). The DNA mass has not been accounted for in the MW calculation. CAUTION: The X-ray exposure time is unlikely to be 2632 seconds.",
  "experiment_description": null,
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 110.8,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": null,
  "porod_mw_error": null,
  "pddf_i0": 4.278,
  "pddf_i0_error": 0.025,
  "guinier_i0": 4.25853,
  "guinier_i0_error": null,
  "pddf_rg": 4.79,
  "pddf_rg_error": 0.037,
  "guinier_rg": 4.611,
  "guinier_rg_error": 0.355,
  "pddf_dmax": 17.6,
  "pddf_dmax_error": null,
  "porod_volume": 236.0,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 1,
  "guinier_point_last": 83,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDVR7_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2024-12-23T14:34:45.224855+01:00",
  "bragg_peak": []
}

{
  "code": "SASDVR7",
  "status": "success",
  "started_at": "2026-08-11T16:41:22.527514+00:00",
  "finished_at": "2026-08-11T16:41:30.507155+00:00",
  "source_last_modified": "2024-12-23T14:34:45.224855+01:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDVR7/",
      "path": "/data/saxsdb/sasbdb/entries/r7/sasdvr7/source/summary.json",
      "size": 7319,
      "sha256": "fcc1a2edc6e505e3cba55f31d5ab62febe958e833a0c9f209e21653f22b57943"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDVR7.dat",
      "path": "/data/saxsdb/sasbdb/entries/r7/sasdvr7/source/SASDVR7.dat",
      "size": 87958,
      "sha256": "cf1e51a0820c5ca40077dff55d78027c123f6b4424129a0d58aa012cf4d0d660",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDVR7.out",
      "path": "/data/saxsdb/sasbdb/entries/r7/sasdvr7/source/SASDVR7.out",
      "size": 150948,
      "sha256": "5a2d1c6187b20befe6b0947dc32ea29a59ee443f5ce333d1d40873542b735a52",
      "role": "pddf"
    },
    {
      "status": "not_available",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDVR7.sascif",
      "path": "/data/saxsdb/sasbdb/entries/r7/sasdvr7/source/SASDVR7.sascif",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDVR7.zip",
      "path": "/data/saxsdb/sasbdb/entries/r7/sasdvr7/source/SASDVR7.zip",
      "size": 69436,
      "sha256": "a1fe8d2316d630acdb6ff8a7e256bb4af73e45cc4f534e6edf85d0807b5600b7",
      "role": "full_entry_zip",
      "zip_member_count": 2,
      "zip_validation": "central_directory_readable"
    }
  ]
}