The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDVT5",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/nm",
"project": {
"title": "The structure and function of the DNA binding domain of class B MpARF2 share more traits with class A AtARF5 than to that of class B AtARF1.",
"publication": {
"title": "The structure and function of the DNA binding domain of class B MpARF2 share more traits with class A AtARF5 than to that of class B AtARF1.",
"author_list": "Crespo I, Malfois M, Rienstra J, Tarrés-Solé A, van den Berg W, Weijers D, Boer DR",
"journal": "Structure",
"doi": "10.1016/j.str.2025.02.006",
"pmid": "40086441",
"published_date": "2025 Mar 7"
},
"status": "released",
"submitted_date": "2024-08-01",
"released_date": "2024-12-09"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDVT5.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDVT5.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDVT5_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDVT5_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDVT5_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDVT5_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDVT5.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "CCD",
"name": "ADSC Quantum 210r",
"resolution": null
},
"name": "ALBA",
"city": "Cerdanyola del Vallès, Barcelona",
"country": "Spain",
"beamline_name": "BL11 - NCD",
"beam_geometry": "",
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Auxin response factor",
"short_name": "MpARF3",
"sequence": "TGLDPQLWHACAGGMVQLPPVGAKVIYFPQGHGEQAATPPEFPRMMGPQ\r\nGTIGCRVVSVSFLADTETDEVYARIRLQPLEREAAMSIADSTLDADGGPS\r\nSPPPEKPASFAKTLTQSDANNGGGFSVPRYCAETIFPPLDYSIDPPVQTV\r\nLAKDVHGERWKFRHIYRGTPRRHLLTTGWSTFVNQKKLVAGDAIVFLRTA\r\nSGELCVGVRRSMRGTGGADSSTWSGGSSTSHHRPNRWEVKGTESFSDFLG\r\nNDSAAGGGSVSSAGSAAGPGGPRAGPGGSNSGPGIGIPGPSTTSSFARNR\r\nARVTAQSVLEAASLAVQGQPFEVVYYPRASTAEFCVKAQAVKAALDHTWF\r\nPGMRFKMAFETEDSSRISWFMGTISAVQPADSLWPKSPWRVLQVTWDEPD\r\nLLQGVSRVSPWQVELVSTLPGNSYSQSM",
"organism": "Marchantia polymorpha",
"uniprot_code": "A0A0G3FJH3",
"uniprot_range_first": 52,
"uniprot_range_last": 470,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MPGPSPGCGTMSGTNIKMEKSEESMGGGGKGWGGGRDRDSSSDGGGGSGENTGLDPQLWH\nACAGGMVQLPPVGAKVIYFPQGHGEQAATPPEFPRMMGPQGTIGCRVVSVSFLADTETDE\nVYARIRLQPLEREAAMSIADSTLDADGGPSSPPPEKPASFAKTLTQSDANNGGGFSVPRY\nCAETIFPPLDYSIDPPVQTVLAKDVHGERWKFRHIYRGTPRRHLLTTGWSTFVNQKKLVA\nGDAIVFLRTASGELCVGVRRSMRGTGGADSSTWSGGSSTSHHRPNRWEVKGTESFSDFLG\nNDSAAGGGSVSSAGSAAGPGGPRAGPGGSNSGPGIGIPGPSTTSSFARNRARVTAQSVLE\nAASLAVQGQPFEVVYYPRASTAEFCVKAQAVKAALDHTWFPGMRFKMAFETEDSSRISWF\nMGTISAVQPADSLWPKSPWRVLQVTWDEPDLLQGVSRVSPWQVELVSTLPMQLPPFSLPK\nKKLRAAQPSDMNMQGQGLMGMPITLPSVFGQINPWAHGLTMEEVTAGMQGARHDRVFGLA\nLSEKFRPGKLPGGFFSAAEGYYPDHAGRGGGGEPHLSAFPLQDRASNISSLISSLGSVPP\nSGDHGSAGALLVPAGSWSGGSANNKSASTQLVLFGQAINTDSNKSQPQHSGGSSCDGPSL\nQHLKEESSGKRKDSPSESNQNENFERGQKYMSGSLSNGKQSDLIVGEFQKWVPGLDKERG\nAGEKLAASPEILQSPQGAW",
"mw": 45.502,
"total_mw": 45.502,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": "The protein construct used for SAXS contains an additional eight non-native amino acid C-terminal extension (GNSYSQSM)."
}
],
"buffer": {
"name": "20 mM Tris-HCl, 150 mM NaCl, 1 mM DTT",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 8.0,
"deuteration": null
},
"purity_method": null,
"name": "Marchantia polymorpha Auxin Response Factor 3",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "Barcelona, Spain",
"full_name": "ALBA - Cells",
"webpage": "https://www.cells.es"
}
],
"contributor_name": "Isidro",
"contributor_surname": "Crespo",
"orcid": "https://orcid.org/0000-0001-7698-1720"
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2019-12-03",
"storage_temperature": 4.0,
"cell_temperature": 20.0,
"exposure_time": 0.5,
"number_of_frames": 20,
"wavelength": 0.1,
"sample_detector_distance": 2.56,
"concentration_min": null,
"concentration_max": 3.5,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.236,
"s_max": 5.82,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDVT5_fit1_model1_img.png",
"software": "GASBOR",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "GASBOR 2.3i (r10552)",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDVT5_fit1_model1.pdb",
"model_mw": null,
"bead_radius": null,
"log": "https://www.sasbdb.org/media/log_files/Mp3sM-35.log",
"symmetry": "P1",
"comment": null,
"user": 1088
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDVT5_fit1_fixed_fit_img.png",
"software": "GASBOR",
"chi_square_value": 0.98,
"p_value": 0.0,
"fit_residual_plot": "SASDVT5_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDVT5_fit1.fir",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/Mp3sM-35.log",
"software_version": "GASBOR 2.3i (r10552)",
"description": ""
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDVT5_fit2_model1_img.png",
"software": "SwissModel",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDVT5_fit2_model1.pdb",
"model_mw": 44.44,
"bead_radius": null,
"log": "https://www.sasbdb.org/media/log_files/report.html",
"symmetry": null,
"comment": null,
"user": 1088
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDVT5_fit2_fixed_fit_img.png",
"software": "CRYSOL",
"chi_square_value": 0.747,
"p_value": 0.0,
"fit_residual_plot": "SASDVT5_fit2_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDVT5_fit2.fit",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/3_5mgmlAverage69-2000_MpARF3_Mp2base.log",
"software_version": "ATSAS 3.3.0 (r14945)",
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": "CAUTION: Dmax appears underestimated.",
"experiment_description": "Synchrotron SAXS data from solutions of M. polymorpha auxin response factor 3 in 20 mM Tris-HCl, 150 mM NaCl, 1 mM DTT, pH 8 were collected on the BL11 - NCD beam line at ALBA (Cerdanyola del Vallès, Barcelona, Spain) using a ADSC Quantum 210r detector at a sample-detector distance of 2.6 m and at a wavelength of λ = 0.1 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). One solute concentration of 3.50 mg/ml was measured at 20°C. 20 successive 0.500 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 42.64,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 36.9,
"porod_mw_error": null,
"pddf_i0": 1.593,
"pddf_i0_error": null,
"guinier_i0": 1.69425,
"guinier_i0_error": null,
"pddf_rg": 2.375,
"pddf_rg_error": null,
"guinier_rg": 2.6,
"guinier_rg_error": 0.018,
"pddf_dmax": 6.16,
"pddf_dmax_error": null,
"porod_volume": 59.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 1,
"guinier_point_last": 92,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDVT5_datloglog_img.png",
"symmetry": null,
"last_modified": "2025-03-20T11:11:00.318393+01:00",
"bragg_peak": []
}
