Arabidopsis thaliana Auxin Response Factor 1 in complex with high affinity DNA

{
  "code": "SASDVV5",
  "status": "Published",
  "type_of_curve": "Single concentration",
  "angular_unit": "1/nm",
  "project": {
    "title": "The structure and function of the DNA binding domain of class B MpARF2 share more traits with class A AtARF5 than to that of class B AtARF1.",
    "publication": {
      "title": "The structure and function of the DNA binding domain of class B MpARF2 share more traits with class A AtARF5 than to that of class B AtARF1.",
      "author_list": "Crespo I, Malfois M, Rienstra J, Tarrés-Solé A, van den Berg W, Weijers D, Boer DR",
      "journal": "Structure",
      "doi": "10.1016/j.str.2025.02.006",
      "pmid": "40086441",
      "published_date": "2025 Mar 7"
    },
    "status": "released",
    "submitted_date": "2024-08-01",
    "released_date": "2024-12-09"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDVV5.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDVV5.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDVV5_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDVV5_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDVV5_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDVV5_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDVV5.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": "CCD",
        "name": "ADSC Quantum 210r",
        "resolution": null
      },
      "name": "ALBA",
      "city": "Cerdanyola del Vallès, Barcelona",
      "country": "Spain",
      "beamline_name": "BL11 - NCD",
      "beam_geometry": "",
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Auxin response factor 1",
          "short_name": "AtARF1",
          "sequence": "MAASNHSSGKPGGVLSDALCRELWHACAGPLVTLPREGERVYYFPEGHME\r\nQLEASMHQGLEQQMPSFNLPSKILCKVINIQRRAEPETDEVYAQITLLPE\r\nLDQSEPTSPDAPVQEPEKCTVHSFCKTLTASDTSTHGGFSVLRRHADDCL\r\nPPLDMSQQPPWQELVATDLHNSEWHFRHIFRGQPRRHLLTTGWSVFVSSK\r\nKLVAGDAFIFLRGENEELRVGVRRHMRQQTNIPSSVISSHSMHIGVLATA\r\nAHAITTGTIFSVFYKPRTSRSEFIVSVNRYLEAKTQKLSVGMRFKMRFEG\r\nEEAPEKRFSGTIVGVQENKSSVWHDSEWRSLKVQWDEPSSVFRPERVSPW\r\nELEPLN",
          "organism": "Arabidopsis thaliana",
          "uniprot_code": "Q8L7G0",
          "uniprot_range_first": 1,
          "uniprot_range_last": 355,
          "oligomerization": "dimer",
          "molecular_type": "protein",
          "uniprot_sequence": "MAASNHSSGKPGGVLSDALCRELWHACAGPLVTLPREGERVYYFPEGHMEQLEASMHQGL\nEQQMPSFNLPSKILCKVINIQRRAEPETDEVYAQITLLPELDQSEPTSPDAPVQEPEKCT\nVHSFCKTLTASDTSTHGGFSVLRRHADDCLPPLDMSQQPPWQELVATDLHNSEWHFRHIF\nRGQPRRHLLTTGWSVFVSSKKLVAGDAFIFLRGENEELRVGVRRHMRQQTNIPSSVISSH\nSMHIGVLATAAHAITTGTIFSVFYKPRTSRSEFIVSVNRYLEAKTQKLSVGMRFKMRFEG\nEEAPEKRFSGTIVGVQENKSSVWHDSEWRSLKVQWDEPSSVFRPERVSPWELEPLVANST\nPSSQPQPPQRNKRPRPPGLPSPATGPSGPVTPDGVWKSPADTPSSVPLFSPPAKAATFGH\nGGNKSFGVSIGSAFWPTNADSAAESFASAFNNESTEKKQTNGNVCRLFGFELVENVNVDE\nCFSAASVSGAVAVDQPVPSNEFDSGQQSEPLNINQSDIPSGSGDPEKSSLRSPQESQSRQ\nIRSCTKVHMQGSAVGRAIDLTRSECYEDLFKKLEEMFDIKGELLESTKKWQVVYTDDEDD\nMMMVGDDPWNEFCGMVRKIFIYTPEEVKKLSPKNKLAVNARMQLKADAEENGNTEGRSSS\nMAGSR",
          "mw": 40.34,
          "total_mw": 80.68,
          "number_molecules": 2,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": "The protein construct used for SAXS encompasses the N-terminal region of the full length protein and contains an additional non-native asparagine at the C-terminus (N356)."
        },
        {
          "long_name": "High Affinity ARF binding sequence inverted repeat with 7 nucleotide spacing",
          "short_name": "HA7",
          "sequence": "T TGTCGG CGATTCG CCGACA A",
          "organism": null,
          "uniprot_code": null,
          "uniprot_range_first": null,
          "uniprot_range_last": null,
          "oligomerization": "dimer",
          "molecular_type": "DNA",
          "uniprot_sequence": "",
          "mw": 6.502,
          "total_mw": 13.004,
          "number_molecules": 2,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": ""
        }
      ],
      "buffer": {
        "name": "20 mM Tris-HCl, 150 mM NaCl, 1 mM DTT",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 8.0,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Arabidopsis thaliana Auxin Response Factor 1 in complex with high affinity DNA",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2019-12-03",
    "storage_temperature": 4.0,
    "cell_temperature": 20.0,
    "exposure_time": 0.5,
    "number_of_frames": 20,
    "wavelength": 0.1,
    "sample_detector_distance": 2.56,
    "concentration_min": null,
    "concentration_max": 3.5,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.08,
    "s_max": 5.82,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "5.0",
  "i0_calibration_standard": null,
  "description": "CAUTION: Dmax appears underestimated.",
  "experiment_description": "Synchrotron SAXS data from solutions of A. thaliana auxin response factor 1 in complex with high affinity DNA in 20 mM Tris-HCl, 150 mM NaCl, 1 mM DTT, pH 8 were collected on the BL11 - NCD beam line at ALBA (Cerdanyola del Vallès, Barcelona, Spain) using a ADSC Quantum 210r detector at a sample-detector distance of 2.6 m and at a wavelength of λ = 0.1 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). One solute concentration of 3.50 mg/ml was measured at 20°C. 20 successive 0.500 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 94.225,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": 90.0,
  "porod_mw_error": null,
  "pddf_i0": 9.22,
  "pddf_i0_error": null,
  "guinier_i0": 9.34434,
  "guinier_i0_error": null,
  "pddf_rg": 3.535,
  "pddf_rg_error": null,
  "guinier_rg": 3.56,
  "guinier_rg_error": 0.019,
  "pddf_dmax": 10.49,
  "pddf_dmax_error": null,
  "porod_volume": 136.0,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 47,
  "guinier_point_last": 99,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDVV5_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2025-03-20T11:11:01.853034+01:00",
  "bragg_peak": []
}

{
  "code": "SASDVV5",
  "status": "success",
  "started_at": "2026-08-11T14:57:25.390967+00:00",
  "finished_at": "2026-08-11T14:57:33.623916+00:00",
  "source_last_modified": "2025-03-20T11:11:01.853034+01:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDVV5/",
      "path": "/data/saxsdb/sasbdb/entries/v5/sasdvv5/source/summary.json",
      "size": 7627,
      "sha256": "94cab192e51cb03e36d690aaa50b068943ff723bfcb173aeccac15eb1e19a9a6"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDVV5.dat",
      "path": "/data/saxsdb/sasbdb/entries/v5/sasdvv5/source/SASDVV5.dat",
      "size": 91634,
      "sha256": "8a96251e02b24e0379a3c593907af528f8660f3e2b472a66cc9ef092dab5479c",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDVV5.out",
      "path": "/data/saxsdb/sasbdb/entries/v5/sasdvv5/source/SASDVV5.out",
      "size": 66877,
      "sha256": "48966e5e798cd53eb4c87d03e650b2fc530fb509df7894da3a646cc2fca24036",
      "role": "pddf"
    },
    {
      "status": "not_available",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDVV5.sascif",
      "path": "/data/saxsdb/sasbdb/entries/v5/sasdvv5/source/SASDVV5.sascif",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDVV5.zip",
      "path": "/data/saxsdb/sasbdb/entries/v5/sasdvv5/source/SASDVV5.zip",
      "size": 43949,
      "sha256": "1bc3b4615f435da929c380b5f88319fa49743638f226216abb83b07a4dd8eaac",
      "role": "full_entry_zip",
      "zip_member_count": 2,
      "zip_validation": "central_directory_readable"
    }
  ]
}