The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDVZ2",
"status": "Published",
"type_of_curve": "SEC-SAS",
"angular_unit": "1/nm",
"project": {
"title": "Molecular structure and enzymatic mechanism of the human collagen hydroxylysine galactosyltransferase GLT25D1/COLGALT1",
"publication": {
"title": "Molecular structure and enzymatic mechanism of the human collagen hydroxylysine galactosyltransferase GLT25D1/COLGALT1",
"author_list": "De Marco M, Rai S, Scietti L, Mattoteia D, Liberi S, Moroni E, Pinnola A, Vetrano A, Iacobucci C, Santambrogio C, Colombo G, Forneris F",
"journal": "Nature Communications",
"doi": "10.1038/s41467-025-59017-5",
"pmid": null,
"published_date": "2025 Apr 16"
},
"status": "released",
"submitted_date": "2024-06-21",
"released_date": "2025-03-19"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDVZ2.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDVZ2.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDVZ2_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDVZ2_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDVZ2_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDVZ2_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDVZ2.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus3 2M",
"resolution": 0.172
},
"name": "ESRF",
"city": "Grenoble",
"country": "France",
"beamline_name": "BM29",
"beam_geometry": "point",
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Procollagen galactosyltransferase 1",
"short_name": "GLT25D1",
"sequence": "GSAPPGADAYFPEERWSPESPLQAPRVLIALLA\r\nRNAAHALPTTLGALERLRHPRERTALWVATDHNMDNTSTVLREWLVAVKSLYHSVEWRPA\r\nEEPRSYPDEEGPKHWSDSRYEHVMKLRQAALKSARDMWADYILFVDADNLILNPDTLSLL\r\nIAENKTVVAPMLDSRAAYSNFWCGMTSQGYYKRTPAYIPIRKRDRRGCFAVPMVHSTFLI\r\nDLRKAASRNLAFYPPHPDYTWSFDDIIVFAFSCKQAEVQMYVCNKEEYGFLPVPLRAHST\r\nLQDEAESFMHVQLEVMVKHPPAEPSRFISAPTKTPDKMGFDEVFMINLRRRQDRRERMLR\r\nALQAQEIECRLVEAVDGKAMNTSQVEALGIQMLPGYRDPYHGRPLTKGELGCFLSHYNIW\r\nKEVVDRGLQKSLVFEDDLRFEIFFKRRLMNLMRDVEREGLDWDLIYVGRKRMQVEHPEKA\r\nVPRVRNLVEADYSYWTLAYVISLQGARKLLAAEPLSKMLPVDEFLPVMFDKHPVSEYKAH\r\nFSLRNLHAFSVEPLLIYPTHYTGDDGYVSDTETSVVWNNEHVKTDWDRAKSQKMREQQAL\r\nSREAKNSDVLQSPLDSAAAAA",
"organism": "Homo sapiens",
"uniprot_code": "Q8NBJ5",
"uniprot_range_first": 30,
"uniprot_range_last": 618,
"oligomerization": "dimer",
"molecular_type": "protein",
"uniprot_sequence": "MAAAPRAGRRRGQPLLALLLLLLAPLPPGAPPGADAYFPEERWSPESPLQAPRVLIALLA\nRNAAHALPTTLGALERLRHPRERTALWVATDHNMDNTSTVLREWLVAVKSLYHSVEWRPA\nEEPRSYPDEEGPKHWSDSRYEHVMKLRQAALKSARDMWADYILFVDADNLILNPDTLSLL\nIAENKTVVAPMLDSRAAYSNFWCGMTSQGYYKRTPAYIPIRKRDRRGCFAVPMVHSTFLI\nDLRKAASRNLAFYPPHPDYTWSFDDIIVFAFSCKQAEVQMYVCNKEEYGFLPVPLRAHST\nLQDEAESFMHVQLEVMVKHPPAEPSRFISAPTKTPDKMGFDEVFMINLRRRQDRRERMLR\nALQAQEIECRLVEAVDGKAMNTSQVEALGIQMLPGYRDPYHGRPLTKGELGCFLSHYNIW\nKEVVDRGLQKSLVFEDDLRFEIFFKRRLMNLMRDVEREGLDWDLIYVGRKRMQVEHPEKA\nVPRVRNLVEADYSYWTLAYVISLQGARKLLAAEPLSKMLPVDEFLPVMFDKHPVSEYKAH\nFSLRNLHAFSVEPLLIYPTHYTGDDGYVSDTETSVVWNNEHVKTDWDRAKSQKMREQQAL\nSREAKNSDVLQSPLDSAARDEL",
"mw": 68.493,
"total_mw": 136.986,
"number_molecules": 2,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": "GLT25D1/COLGALT1 was produced recombinantly as a N-terminal 8xHis-SUMO fusion in E. coli. After initial affinity chromatography, the sample was subject to tag removal using His-tagged SUMO protease followed by reverse affinity chromatography and dialysis. The sample was then subject to anion exchange chromatography for further polishing, followed by gel filtration into a Superdex 200 Increase 10/300 GL (Cytiva), equilibrated with 25 mM HEPES/NaOH, 100 mM NaCl, pH 8.0. The sample was concentrated to 4 mg/mL in a 30 kDa MWCO Vivaspin Turbo centrifugal filter (Sartorius) and used for SEC-SAXS analysis"
}
],
"buffer": {
"name": "25 mM HEPES, 0.1 M NaCl",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 8.0,
"deuteration": null
},
"purity_method": null,
"name": "Human Collagen Galactosyltransferase GLT25D1/COLGALT1",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "Italy",
"full_name": "University of Pavia",
"webpage": "http://wcm-3.unipv.it"
}
],
"contributor_name": "Federico",
"contributor_surname": "Forneris",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2022-06-05",
"storage_temperature": 10.0,
"cell_temperature": 20.0,
"exposure_time": 1.0,
"number_of_frames": 1200,
"wavelength": 0.099187,
"sample_detector_distance": 2.867,
"concentration_min": null,
"concentration_max": 4.0,
"sample_volume": 50.0,
"flow_rate": 0.06,
"s_min": 0.131,
"s_max": 3.145,
"total_exposure_time": null,
"seccolumn": 14
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDVZ2_fit1_model1_img.png",
"software": "CORAL",
"pdb_link": [],
"model_title": null,
"type_of_model": "mix",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDVZ2_fit1_model1.pdb",
"model_mw": 134.6,
"bead_radius": 1.9,
"log": null,
"symmetry": "P1",
"comment": "UNK residues have been renumbered according to protein residue numbering",
"user": 294
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDVZ2_fit1_fixed_fit_img.png",
"software": "CORAL",
"chi_square_value": 1.889999,
"p_value": 0.0,
"fit_residual_plot": "SASDVZ2_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDVZ2_fit1.fit",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/glt_agai.log",
"software_version": null,
"description": "The crystal structure of human full-length GLT25D1/COLGALT1 was subject to loop modeling using CORAL, to introduce the missing N- and C-terminal loops on the dimeric ensemble."
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": null,
"i0_calibration_standard": null,
"description": null,
"experiment_description": null,
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 136.0,
"experimental_mw_error": null,
"guinier_i0_mw": 131.0,
"guinier_i0_mw_error": 10.0,
"porod_mw": 114.0,
"porod_mw_error": null,
"pddf_i0": null,
"pddf_i0_error": null,
"guinier_i0": 22.9078,
"guinier_i0_error": null,
"pddf_rg": null,
"pddf_rg_error": null,
"guinier_rg": 4.33,
"guinier_rg_error": 0.021,
"pddf_dmax": 13.97,
"pddf_dmax_error": null,
"porod_volume": 184.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 10,
"guinier_point_last": 33,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDVZ2_datloglog_img.png",
"symmetry": null,
"last_modified": "2025-04-16T23:25:08.209553+02:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDVZ2",
"status": "success",
"started_at": "2026-08-11T13:50:23.961966+00:00",
"finished_at": "2026-08-11T13:50:32.162151+00:00",
"source_last_modified": "2025-04-16T23:25:08.209553+02:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDVZ2/",
"path": "/data/saxsdb/sasbdb/entries/z2/sasdvz2/source/summary.json",
"size": 8487,
"sha256": "7db1ec1a2dbe2cbfc29f73f9c127fb5b2c4fdfb4bc3af394fb589a3a136a5309"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDVZ2.dat",
"path": "/data/saxsdb/sasbdb/entries/z2/sasdvz2/source/SASDVZ2.dat",
"size": 30206,
"sha256": "b6b11cb3809f81191acf9dad869591007313bdc27dcd1ed7f3f9e827bad6d6b1",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDVZ2.out",
"path": "/data/saxsdb/sasbdb/entries/z2/sasdvz2/source/SASDVZ2.out",
"size": 34915,
"sha256": "64c761aa214f3909e6de8745e2253e01c13460fb5cca4d85c3318a3c11b0881a",
"role": "pddf"
},
{
"status": "not_available",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDVZ2.sascif",
"path": "/data/saxsdb/sasbdb/entries/z2/sasdvz2/source/SASDVZ2.sascif",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDVZ2.zip",
"path": "/data/saxsdb/sasbdb/entries/z2/sasdvz2/source/SASDVZ2.zip",
"size": 176815,
"sha256": "e565fef9bb58a2ab346d87d4addb470127ebe44c1dbac3d43f5cdfb4ba61b941",
"role": "full_entry_zip",
"zip_member_count": 4,
"zip_validation": "central_directory_readable"
}
]
}
