The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDW56",
"status": "Published",
"type_of_curve": "SEC-SAS",
"angular_unit": "1/A",
"project": {
"title": "Breaking new ground into RAD51–BRC repeats interplay in Homologous Recombination",
"publication": {
"title": "Breaking new ground into RAD51–BRC repeats interplay in Homologous Recombination",
"author_list": "Rinaldi F, Franco P, Veronesi M, Romeo E, Bresciani V, Varignani G, Catalano F, Bernetti M, Masetti M, Langer J, Girotto S, Cavalli A",
"journal": null,
"doi": "10.1101/2025.11.13.688182",
"pmid": null,
"published_date": "2025 Nov 13"
},
"status": "released",
"submitted_date": "2025-01-24",
"released_date": "2026-01-24"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDW56.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDW56.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDW56_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDW56_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDW56_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDW56_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDW56.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Eiger 4M",
"resolution": 75.0
},
"name": "Diamond Light Source",
"city": "Didcot",
"country": "UK",
"beamline_name": "B21",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "DNA repair protein RAD51 homolog 1 (F86E A89E)",
"short_name": "RAD51 F86E A89E",
"sequence": "GMAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKE\r\nLINIKGISEAKADKILAEAAKLVPMGETTETEFHQRRSEIIQITTGSKELDKLLQGGIET\r\nGSITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYG\r\nLSGSDVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELS\r\nARQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTR\r\nLYLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD",
"organism": "Homo sapiens",
"uniprot_code": "Q06609",
"uniprot_range_first": 1,
"uniprot_range_last": 339,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKEL\nINIKGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETG\nSITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGL\nSGSDVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSA\nRQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRL\nYLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD",
"mw": 37.063,
"total_mw": 37.063,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": "Human Recombinase RAD51 with two point mutations in the oligomerization linker F86E and A89E."
},
{
"long_name": "Breast cancer type 2 susceptibility protein (BRC repeat 2)",
"short_name": "BRC2",
"sequence": "GWHMNEVGFRGFYSAHGTKLNVSTEALQKAVKLFSDIEN",
"organism": "Homo sapiens",
"uniprot_code": "P51587",
"uniprot_range_first": 1212,
"uniprot_range_last": 1246,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MPIGSKERPTFFEIFKTRCNKADLGPISLNWFEELSSEAPPYNSEPAEESEHKNNNYEPN\nLFKTPQRKPSYNQLASTPIIFKEQGLTLPLYQSPVKELDKFKLDLGRNVPNSRHKSLRTV\nKTKMDQADDVSCPLLNSCLSESPVVLQCTHVTPQRDKSVVCGSLFHTPKFVKGRQTPKHI\nSESLGAEVDPDMSWSSSLATPPTLSSTVLIVRNEEASETVFPHDTTANVKSYFSNHDESL\nKKNDRFIASVTDSENTNQREAASHGFGKTSGNSFKVNSCKDHIGKSMPNVLEDEVYETVV\nDTSEEDSFSLCFSKCRTKNLQKVRTSKTRKKIFHEANADECEKSKNQVKEKYSFVSEVEP\nNDTDPLDSNVANQKPFESGSDKISKEVVPSLACEWSQLTLSGLNGAQMEKIPLLHISSCD\nQNISEKDLLDTENKRKKDFLTSENSLPRISSLPKSEKPLNEETVVNKRDEEQHLESHTDC\nILAVKQAISGTSPVASSFQGIKKSIFRIRESPKETFNASFSGHMTDPNFKKETEASESGL\nEIHTVCSQKEDSLCPNLIDNGSWPATTTQNSVALKNAGLISTLKKKTNKFIYAIHDETSY\nKGKKIPKDQKSELINCSAQFEANAFEAPLTFANADSGLLHSSVKRSCSQNDSEEPTLSLT\nSSFGTILRKCSRNETCSNNTVISQDLDYKEAKCNKEKLQLFITPEADSLSCLQEGQCEND\nPKSKKVSDIKEEVLAAACHPVQHSKVEYSDTDFQSQKSLLYDHENASTLILTPTSKDVLS\nNLVMISRGKESYKMSDKLKGNNYESDVELTKNIPMEKNQDVCALNENYKNVELLPPEKYM\nRVASPSRKVQFNQNTNLRVIQKNQEETTSISKITVNPDSEELFSDNENNFVFQVANERNN\nLALGNTKELHETDLTCVNEPIFKNSTMVLYGDTGDKQATQVSIKKDLVYVLAEENKNSVK\nQHIKMTLGQDLKSDISLNIDKIPEKNNDYMNKWAGLLGPISNHSFGGSFRTASNKEIKLS\nEHNIKKSKMFFKDIEEQYPTSLACVEIVNTLALDNQKKLSKPQSINTVSAHLQSSVVVSD\nCKNSHITPQMLFSKQDFNSNHNLTPSQKAEITELSTILEESGSQFEFTQFRKPSYILQKS\nTFEVPENQMTILKTTSEECRDADLHVIMNAPSIGQVDSSKQFEGTVEIKRKFAGLLKNDC\nNKSASGYLTDENEVGFRGFYSAHGTKLNVSTEALQKAVKLFSDIENISEETSAEVHPISL\nSSSKCHDSVVSMFKIENHNDKTVSEKNNKCQLILQNNIEMTTGTFVEEITENYKRNTENE\nDNKYTAASRNSHNLEFDGSDSSKNDTVCIHKDETDLLFTDQHNICLKLSGQFMKEGNTQI\nKEDLSDLTFLEVAKAQEACHGNTSNKEQLTATKTEQNIKDFETSDTFFQTASGKNISVAK\nESFNKIVNFFDQKPEELHNFSLNSELHSDIRKNKMDILSYEETDIVKHKILKESVPVGTG\nNQLVTFQGQPERDEKIKEPTLLGFHTASGKKVKIAKESLDKVKNLFDEKEQGTSEITSFS\nHQWAKTLKYREACKDLELACETIEITAAPKCKEMQNSLNNDKNLVSIETVVPPKLLSDNL\nCRQTENLKTSKSIFLKVKVHENVEKETAKSPATCYTNQSPYSVIENSALAFYTSCSRKTS\nVSQTSLLEAKKWLREGIFDGQPERINTADYVGNYLYENNSNSTIAENDKNHLSEKQDTYL\nSNSSMSNSYSYHSDEVYNDSGYLSKNKLDSGIEPVLKNVEDQKNTSFSKVISNVKDANAY\nPQTVNEDICVEELVTSSSPCKNKNAAIKLSISNSNNFEVGPPAFRIASGKIVCVSHETIK\nKVKDIFTDSFSKVIKENNENKSKICQTKIMAGCYEALDDSEDILHNSLDNDECSTHSHKV\nFADIQSEEILQHNQNMSGLEKVSKISPCDVSLETSDICKCSIGKLHKSVSSANTCGIFST\nASGKSVQVSDASLQNARQVFSEIEDSTKQVFSKVLFKSNEHSDQLTREENTAIRTPEHLI\nSQKGFSYNVVNSSAFSGFSTASGKQVSILESSLHKVKGVLEEFDLIRTEHSLHYSPTSRQ\nNVSKILPRVDKRNPEHCVNSEMEKTCSKEFKLSNNLNVEGGSSENNHSIKVSPYLSQFQQ\nDKQQLVLGTKVSLVENIHVLGKEQASPKNVKMEIGKTETFSDVPVKTNIEVCSTYSKDSE\nNYFETEAVEIAKAFMEDDELTDSKLPSHATHSLFTCPENEEMVLSNSRIGKRRGEPLILV\nGEPSIKRNLLNEFDRIIENQEKSLKASKSTPDGTIKDRRLFMHHVSLEPITCVPFRTTKE\nRQEIQNPNFTAPGQEFLSKSHLYEHLTLEKSSSNLAVSGHPFYQVSATRNEKMRHLITTG\nRPTKVFVPPFKTKSHFHRVEQCVRNINLEENRQKQNIDGHGSDDSKNKINDNEIHQFNKN\nNSNQAVAVTFTKCEEEPLDLITSLQNARDIQDMRIKKKQRQRVFPQPGSLYLAKTSTLPR\nISLKAAVGGQVPSACSHKQLYTYGVSKHCIKINSKNAESFQFHTEDYFGKESLWTGKGIQ\nLADGGWLIPSNDGKAGKEEFYRALCDTPGVDPKLISRIWVYNHYRWIIWKLAAMECAFPK\nEFANRCLSPERVLLQLKYRYDTEIDRSRRSAIKKIMERDDTAAKTLVLCVSDIISLSANI\nSETSSNKTSSADTQKVAIIELTDGWYAVKAQLDPPLLAVLKNGRLTVGQKIILHGAELVG\nSPDACTPLEAPESLMLKISANSTRPARWYTKLGFFPDPRPFPLPLSSLFSDGGNVGCVDV\nIIQRAYPIQWMEKTSSGLYIFRNEREEEKEAAKYVEAQQKRLEALFTKIQEEFEEHEENT\nTKPYLPSRALTRQQVRALQDGAELYEAVKNAADPAYLEGYFSEEQLRALNNHRQMLNDKK\nQAQIQLEIRKAMESAEQKEQGLSRDVTTVWKLRIVSYSKKEKDSVILSIWRPSSDLYSLL\nTEGKRYRIYHLATSKSKSKSERANIQLAATKKTQYQQLPVSDEILFQIYQPREPLHFSKF\nLDPDFQPSCSEVDLIGFVVSVVKKTGLAPFVYLSDECYNLLAIKFWIDLNEDIIKPHMLI\nAASNLQWRPESKSGLLTLFAGDFSVFSASPKEGHFQETFNKMKNTVENIDILCNEAENKL\nMHILHANDPKWSTPTKDCTSGPYTAQIIPGTGNKLLMSSPNCEIYYQSPLSLCMAKRKSV\nSTPVSAQMTSKSCKGEKEIDDQKNCKKRRALDFLSRLPLPPPVSPICTFVSPAAQKAFQP\nPRSCGTKYETPIKKKELNSPQMTPFKKFNEISLLESNSIADEELALINTQALLSGSTGEK\nQFISVSESTRTAPTSSEDYLRLKRRCTTSLIKEQESSQASTEECEKNKQDTITTKKYI",
"mw": 4.383,
"total_mw": 4.383,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": "Second BRC repeat of Breast cancer type 2 susceptibility protein. The construct used for SAXS contains an additional four non-native amino acids at the N-terminus (GWHM)."
}
],
"buffer": {
"name": "20 mM K₂HPO₄/KH₂PO₄, 100 mM NaCl, 200 mM Li₂SO₄, 1 mM DTT, 2% sucrose",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 8.0,
"deuteration": null
},
"purity_method": null,
"name": "RAD51 [F86E, A89E] in complex with second BRC repeat (BRC2) SEC-SAXS",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": null,
"full_name": "istituto italiano di tecnologia",
"webpage": null
}
],
"contributor_name": "Francesco",
"contributor_surname": "Rinaldi",
"orcid": "https://orcid.org/0000-0001-7042-2071"
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2024-05-02",
"storage_temperature": 15.0,
"cell_temperature": 15.0,
"exposure_time": 3.0,
"number_of_frames": 600,
"wavelength": 0.09464,
"sample_detector_distance": 3.6929,
"concentration_min": null,
"concentration_max": 6.13,
"sample_volume": 100.0,
"flow_rate": 0.07,
"s_min": 0.045,
"s_max": 3.4,
"total_exposure_time": null,
"seccolumn": 48
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDW56_fit1_model1_img.png",
"software": "AlphaFold",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": "3.0",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDW56_fit1_model1.pdb",
"model_mw": 41.43,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": null,
"user": 868
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDW56_fit1_model2_img.png",
"software": "AlphaFold",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": "3.0",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDW56_fit1_model2.pdb",
"model_mw": 41.43,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": null,
"user": 868
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDW56_fit1_fitfoxs_img.png",
"software": "MultiFoXS",
"chi_square_value": 1.28506,
"p_value": 0.0009,
"fit_residual_plot": "SASDW56_fit1_fitfoxsresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDW56_fit1.dat",
"fit_log": null,
"software_version": null,
"description": ""
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDW56_fit2_model1_img.png",
"software": "AlphaFold",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": "3.0",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDW56_fit2_model1.pdb",
"model_mw": 41.43,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": null,
"user": 868
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDW56_fit2_fixed_fit_img.png",
"software": "FoXS",
"chi_square_value": 7.221338,
"p_value": 0.0,
"fit_residual_plot": "SASDW56_fit2_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDW56_fit2.fit",
"fit_log": null,
"software_version": null,
"description": ""
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDW56_fit3_model1_img.png",
"software": "AlphaFold",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": "3.0",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDW56_fit3_model1.pdb",
"model_mw": 41.43,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": null,
"user": 868
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/fold_rad51_fl_brc2_brc4_model_4_RAD51BRC26p13Modelling_fixed_fit_img.png",
"software": "FoXS",
"chi_square_value": 1.395513,
"p_value": 0.0,
"fit_residual_plot": "fold_rad51_fl_brc2_brc4_model_4_RAD51BRC26p13Modelling_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/fold_rad51_fl_brc2_brc4_model_4_RAD51BRC26p13Modelling.fit",
"fit_log": null,
"software_version": null,
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": null,
"i0_calibration_standard": null,
"description": "Molecular weight has been inferred through Volume of Correlation (Vc). Sample molecular weight and monodispersity has been independently confirmed through static light scattering (SLS). 34 successive frames were collected through the sample elution peak (from a total of 600 frames).",
"experiment_description": null,
"tags": [],
"intensity_unit": "1/cm",
"experimental_mw": 37.9,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 42.0,
"porod_mw_error": null,
"pddf_i0": 0.056,
"pddf_i0_error": null,
"guinier_i0": 0.0560948,
"guinier_i0_error": null,
"pddf_rg": 2.75,
"pddf_rg_error": null,
"guinier_rg": 2.731,
"guinier_rg_error": 0.067,
"pddf_dmax": 9.6,
"pddf_dmax_error": null,
"porod_volume": 67.4,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 40,
"guinier_point_last": 253,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDW56_datloglog_img.png",
"symmetry": null,
"last_modified": "2026-02-10T10:01:10.049582+01:00",
"bragg_peak": []
}
