The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDW82",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/A",
"project": {
"title": "Tangled Up in Fibers: How a Multidomain Lytic Polysaccharide Monooxygenase Binds Its Chitin Substrate.",
"publication": {
"title": "Tangled Up in Fibers: How a Multidomain Lytic Polysaccharide Monooxygenase Binds Its Chitin Substrate.",
"author_list": "Sørensen HV, Montserrat-Canals M, Coder A, Prévost S, Krueger S, Vaaje-Kolstad G, Bjerregaard-Andersen K, Lund R, Krengel U",
"journal": "ACS Appl Mater Interfaces",
"doi": "10.1021/acsami.5c24418",
"pmid": "41709583",
"published_date": "2026 Feb 18"
},
"status": "released",
"submitted_date": "2024-11-19",
"released_date": "2025-02-09"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDW82.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDW82.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDW82_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDW82_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDW82_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDW82_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDW82.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "3-He gas detector",
"name": "CERCA",
"resolution": 7.5
},
"name": "ILL",
"city": "Grenoble",
"country": "France",
"beamline_name": "D11",
"beam_geometry": null,
"type_of_source": "neutron source",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "GlcNAc-binding protein A (perdeuterated)",
"short_name": "D-GbpA",
"sequence": "HGYVSAVENGVAEGRVTLCKFAANGTGEKNTHCGAIQYEPQSVEGPDGFPVTGPRDGKIASAESALAAALDEQTADRWVKRPIQAGPQTFEWTFTANHVTKDWKYYITKPNWNPNQPLSRDAFDLNPFCVVEGNMVQPPKRVSHECIVPEREGYQVILAVWDVGDTAASFYNVIDVKFDGNGPVLPDWNPAGQIIPSMDLSIGDTVYTRVFDNDGENPAYRTELKIDSETLTKANQWSYALATKINQTQKQQRAGQLNGDQFVPVYGTNPIYLKEGSGLKSVEIGYQIEAPQPEYSLTVSGLAKEYEIGEQPIQLDLTLEAQGEMSAELTVYNHHQKPLASWSQAMTDGELKSITLELSEAKAGHHMLVSRIKDRDGNLQDQQTLDFMLVEPQTPPTPGDYDFVFPNGLKEYVAGTKVLASDGAIYQCKPWPYSGYCQQWTSNATQYQPGTGSHWEMAWDKR",
"organism": "Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)",
"uniprot_code": "Q9KLD5",
"uniprot_range_first": 24,
"uniprot_range_last": 485,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MKKQPKMTAIALILSGISGLAYGHGYVSAVENGVAEGRVTLCKFAANGTGEKNTHCGAIQ\nYEPQSVEGPDGFPVTGPRDGKIASAESALAAALDEQTADRWVKRPIQAGPQTFEWTFTAN\nHVTKDWKYYITKPNWNPNQPLSRDAFDLNPFCVVEGNMVQPPKRVSHECIVPEREGYQVI\nLAVWDVGDTAASFYNVIDVKFDGNGPVLPDWNPAGQIIPSMDLSIGDTVYTRVFDNDGEN\nPAYRTELKIDSETLTKANQWSYALATKINQTQKQQRAGQLNGDQFVPVYGTNPIYLKEGS\nGLKSVEIGYQIEAPQPEYSLTVSGLAKEYEIGEQPIQLDLTLEAQGEMSAELTVYNHHQK\nPLASWSQAMTDGELKSITLELSEAKAGHHMLVSRIKDRDGNLQDQQTLDFMLVEPQTPPT\nPGDYDFVFPNGLKEYVAGTKVLASDGAIYQCKPWPYSGYCQQWTSNATQYQPGTGSHWEM\nAWDKR",
"mw": 51.253,
"total_mw": 51.253,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": "97 % average non-exchangeable deuteration through production in E.coli cultures grown in D₂O and deuterated carbon sources."
}
],
"buffer": {
"name": "100 mM NaCl, 20 mM Tris, 47% v/v D₂O",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 8.0,
"deuteration": null
},
"purity_method": null,
"name": "Perdeuterated N-acetylglucosamine binding Protein A (D-GbpA) in 47 % D₂O, 2.4 mg/mL",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": null,
"full_name": "Lund University",
"webpage": null
}
],
"contributor_name": "Henrik Vinther",
"contributor_surname": "Sørensen",
"orcid": "https://orcid.org/0000-0003-3057-5668"
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2019-09-21",
"storage_temperature": 5.0,
"cell_temperature": 25.0,
"exposure_time": 1500.0,
"number_of_frames": 1,
"wavelength": 0.56,
"sample_detector_distance": 1.7,
"concentration_min": null,
"concentration_max": 2.4,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.016,
"s_max": 4.089,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": null,
"experiment_description": "SANS data from solutions of perdeuterated N-acetylglucosamine binding Protein A (D-GbpA) in 100 mM NaCl, 20 mM Tris, 47% v/v D₂O, pH 8 were collected on the D11 beam line at the Institut Laue-Langevin (ILL; Grenoble, France). Data recorded as I(s) vs s (where s = 4πsinθ/λ, and 2θ is the scattering angle), were collected at a sample concentration of 2.4 mg/mL at 25 degrees centigrade using three instrument configurations: Set-up 1: Sample-Detector distance, 1.7 m; Collimation distance, 5.5 m; Wavelength, 0.56 nm; Frames, 1; Time per frame, 1500 s. Set-up 2: Sample-Detector distance, 8.0 m; Collimation distance, 8.0 m; Wavelength, 0.56 nm; Frames, 1; Time per frame, 1500 s. Set-up 3: Sample-Detector distance, 38.95 m; Collimation distance, 40.0 m; Wavelength, 0.56 nm; Frames, 1; Time per frame, 2100 s.",
"tags": [],
"intensity_unit": "1/cm",
"experimental_mw": 44.0,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": null,
"porod_mw_error": null,
"pddf_i0": 0.1215,
"pddf_i0_error": null,
"guinier_i0": 0.122998,
"guinier_i0_error": null,
"pddf_rg": 3.73,
"pddf_rg_error": null,
"guinier_rg": 3.699,
"guinier_rg_error": 0.628,
"pddf_dmax": 12.7,
"pddf_dmax_error": null,
"porod_volume": null,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 23,
"guinier_point_last": 104,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDW82_datloglog_img.png",
"symmetry": null,
"last_modified": "2026-02-23T16:31:10.879589+01:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDW82",
"status": "success",
"started_at": "2026-08-11T16:51:35.589116+00:00",
"finished_at": "2026-08-11T16:51:42.040327+00:00",
"source_last_modified": "2026-02-23T16:31:10.879589+01:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDW82/",
"path": "/data/saxsdb/sasbdb/entries/82/sasdw82/source/summary.json",
"size": 7278,
"sha256": "d84640224714d66b96492f2cd6a3d89998529c7156d8a3eacab75b1f0a04ee55"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDW82.dat",
"path": "/data/saxsdb/sasbdb/entries/82/sasdw82/source/SASDW82.dat",
"size": 11399,
"sha256": "04689c6fd89ebb52904f20ec30051f80cd6888f9adfd719a4f25fb6f26632431",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDW82.out",
"path": "/data/saxsdb/sasbdb/entries/82/sasdw82/source/SASDW82.out",
"size": 24477,
"sha256": "b5763f3ee3a90162149f9d63411c686ecf05d4410249773fe0dc4515284e7564",
"role": "pddf"
},
{
"status": "not_available",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDW82.sascif",
"path": "/data/saxsdb/sasbdb/entries/82/sasdw82/source/SASDW82.sascif",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDW82.zip",
"path": "/data/saxsdb/sasbdb/entries/82/sasdw82/source/SASDW82.zip",
"size": 11668,
"sha256": "d4bb1adb7ba286cf0c26337e457526be1aff17fe599b0690f3b02a39cdf1827d",
"role": "full_entry_zip",
"zip_member_count": 2,
"zip_validation": "central_directory_readable"
}
]
}
