Bovine serum albumin, monomer from SEC-SANS

{
  "code": "SASDWB3",
  "status": "Published",
  "type_of_curve": "SEC-SAS",
  "angular_unit": "1/A",
  "project": {
    "title": "Size-exclusion chromatography–small-angle neutron scattering system optimized for an instrument with medium neutron flux",
    "publication": {
      "title": "Size-exclusion chromatography–small-angle neutron scattering system optimized for an instrument with medium neutron flux",
      "author_list": "Morishima K, Inoue R, Nakagawa T, Shimizu M, Sakamoto R, Oda T, Mayumi K, Sugiyama M",
      "journal": "Journal of Applied Crystallography",
      "doi": "10.1107/S1600576725000779",
      "pmid": null,
      "published_date": "2025 Feb 11"
    },
    "status": "released",
    "submitted_date": "2024-12-09",
    "released_date": "2025-02-12"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDWB3.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDWB3.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDWB3_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDWB3_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDWB3_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDWB3_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDWB3.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": "3He position sensitive detector (PSD)",
        "name": "ORDELA, model 2660N",
        "resolution": 5.0
      },
      "name": "JRR-3 (Japan Atomic Energy Agency)",
      "city": "Ibaraki",
      "country": "Japan",
      "beamline_name": "SANS-U",
      "beam_geometry": null,
      "type_of_source": "neutron source",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Albumin (natural variant A214T)",
          "short_name": "BSA",
          "sequence": "DTHKSEIAHRFKDLGEEHFKGLVLIAFSQYLQQCPFDEHVKLVNELTEFAKTCVADESHAGCEKSLHTLFGDELCKVASLRETYGDMADCCEKQEPERNECFLSHKDDSPDLPKLKPDPNTLCDEFKADEKKFWGKYLYEIARRHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPKIETMREKVLTSSARQRLRCASIQKFGERALKAWSVARLSQKFPKAEFVEVTKLVTDLTKVHKECCHGDLLECADDRADLAKYICDNQDTISSKLKECCDKPLLEKSHCIAEVEKDAIPENLPPLTADFAEDKDVCKNYQEAKDAFLGSFLYEYSRRHPEYAVSVLLRLAKEYEATLEECCAKDDPHACYSTVFDKLKHLVDEPQNLIKQNCDQFEKLGEYGFQNALIVRYTRKVPQVSTPTLVEVSRSLGKVGTRCCTKPESERMPCTEDYLSLILNRLCVLHEKTPVSEKVTKCCTESLVNRRPCFSALTPDETYVPKAFDEKLFTFHADICTLPDTEKQIKKQTALVELLKHKPKATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPKLVVSTQTALA",
          "organism": "Bos taurus",
          "uniprot_code": "P02769",
          "uniprot_range_first": null,
          "uniprot_range_last": null,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MKWVTFISLLLLFSSAYSRGVFRRDTHKSEIAHRFKDLGEEHFKGLVLIAFSQYLQQCPF\nDEHVKLVNELTEFAKTCVADESHAGCEKSLHTLFGDELCKVASLRETYGDMADCCEKQEP\nERNECFLSHKDDSPDLPKLKPDPNTLCDEFKADEKKFWGKYLYEIARRHPYFYAPELLYY\nANKYNGVFQECCQAEDKGACLLPKIETMREKVLASSARQRLRCASIQKFGERALKAWSVA\nRLSQKFPKAEFVEVTKLVTDLTKVHKECCHGDLLECADDRADLAKYICDNQDTISSKLKE\nCCDKPLLEKSHCIAEVEKDAIPENLPPLTADFAEDKDVCKNYQEAKDAFLGSFLYEYSRR\nHPEYAVSVLLRLAKEYEATLEECCAKDDPHACYSTVFDKLKHLVDEPQNLIKQNCDQFEK\nLGEYGFQNALIVRYTRKVPQVSTPTLVEVSRSLGKVGTRCCTKPESERMPCTEDYLSLIL\nNRLCVLHEKTPVSEKVTKCCTESLVNRRPCFSALTPDETYVPKAFDEKLFTFHADICTLP\nDTEKQIKKQTALVELLKHKPKATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPKLVV\nSTQTALA",
          "mw": 66.462,
          "total_mw": 66.462,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": ""
        }
      ],
      "buffer": {
        "name": "100 mM Tris-HCl, 100 mM NaCl in 100% v/v D₂O",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 7.5,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Bovine serum albumin, monomer from SEC-SANS",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": null,
            "full_name": "Kyoto University",
            "webpage": null
          }
        ],
        "contributor_name": "Ken",
        "contributor_surname": "Morishima",
        "orcid": "https://orcid.org/0000-0003-1091-3850"
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2024-04-22",
    "storage_temperature": 10.0,
    "cell_temperature": 25.0,
    "exposure_time": 600.0,
    "number_of_frames": 24,
    "wavelength": 0.6,
    "sample_detector_distance": 4.0,
    "concentration_min": null,
    "concentration_max": 7.7,
    "sample_volume": 500.0,
    "flow_rate": 0.0,
    "s_min": 0.104,
    "s_max": 3.919,
    "total_exposure_time": null,
    "seccolumn": 47
  },
  "fits": [
    {
      "models": [
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDWB3_fit1_model1_img.png",
          "software": "PDB (Protein Data Bank)",
          "pdb_link": [
            {
              "pdb_code": "4f5s",
              "ext_code": "4F5S",
              "ext_type": "pdb",
              "difference_with_model": "identical"
            }
          ],
          "model_title": null,
          "type_of_model": "atomic",
          "software_version": null,
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDWB3_fit1_model1.pdb",
          "model_mw": 66.44,
          "bead_radius": null,
          "log": null,
          "symmetry": null,
          "comment": null,
          "user": 1158
        }
      ],
      "fit_unit": "1/A",
      "fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDWB3_fit1_fixed_fit_img.png",
      "software": "CRYSON",
      "chi_square_value": 2.3876,
      "p_value": 0.1331,
      "fit_residual_plot": "SASDWB3_fit1_fitresiduals_img.png",
      "fit_data": "https://www.sasbdb.org/media/fitting_files/SASDWB3_fit1.fit",
      "fit_log": null,
      "software_version": null,
      "description": ""
    }
  ],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": null,
  "i0_calibration_standard": null,
  "description": "SEC elution paused during SANS measurements.",
  "experiment_description": "SANS data from solutions of bovine serum albumin in 100 mM Tris-HCl, 100 mM NaCl in 100% v/v D₂O, pH 7.5 were collected on the SANS-U beam line at JRR-3 (Japan Atomic Energy Agency; Ibaraki, Japan) using a ORDELA, model 2660N detector at a sample-detector distance of 4 and 1.03 m at a wavelength of λ = 0.6 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). In-line size-exclusion chromatography (SEC) SAS was employed. The SEC parameters were as follows: A 500.00 μl sample at 7.7 mg/ml was injected onto a Cytiva Superdex 200 Increase 10/300 column at 25°C. 24 successive 600 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
  "tags": [],
  "intensity_unit": "1/cm",
  "experimental_mw": 69.8,
  "experimental_mw_error": null,
  "guinier_i0_mw": 69.8,
  "guinier_i0_mw_error": 1.9,
  "porod_mw": null,
  "porod_mw_error": null,
  "pddf_i0": 0.1362,
  "pddf_i0_error": null,
  "guinier_i0": 0.132733,
  "guinier_i0_error": null,
  "pddf_rg": 2.68,
  "pddf_rg_error": null,
  "guinier_rg": 2.56,
  "guinier_rg_error": 0.06,
  "pddf_dmax": 8.65,
  "pddf_dmax_error": null,
  "porod_volume": null,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 11,
  "guinier_point_last": 32,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDWB3_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2025-02-12T13:44:33.974923+01:00",
  "bragg_peak": []
}

{
  "code": "SASDWB3",
  "status": "success",
  "started_at": "2026-08-11T13:57:01.104940+00:00",
  "finished_at": "2026-08-11T13:57:08.553314+00:00",
  "source_last_modified": "2025-02-12T13:44:33.974923+01:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDWB3/",
      "path": "/data/saxsdb/sasbdb/entries/b3/sasdwb3/source/summary.json",
      "size": 8569,
      "sha256": "ec5c58b6e7d64853e4d6149daa41d4297cc1863eb07915599b468961c2bcec9d"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDWB3.dat",
      "path": "/data/saxsdb/sasbdb/entries/b3/sasdwb3/source/SASDWB3.dat",
      "size": 4806,
      "sha256": "14db736f17cfd5eed678878d9626c2f1f46f36549a00ff5ef481bdb077e1b166",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDWB3.out",
      "path": "/data/saxsdb/sasbdb/entries/b3/sasdwb3/source/SASDWB3.out",
      "size": 11564,
      "sha256": "cba753e60d11cb4218df7a324c7f2b3e4b373a427d9905d9903970fcdc18d642",
      "role": "pddf"
    },
    {
      "status": "not_available",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDWB3.sascif",
      "path": "/data/saxsdb/sasbdb/entries/b3/sasdwb3/source/SASDWB3.sascif",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDWB3.zip",
      "path": "/data/saxsdb/sasbdb/entries/b3/sasdwb3/source/SASDWB3.zip",
      "size": 299777,
      "sha256": "e2ec8065968c2e0245cb332d8fd0324f3eb9fdd50a976dd04c250a5044bdeed8",
      "role": "full_entry_zip",
      "zip_member_count": 4,
      "zip_validation": "central_directory_readable"
    }
  ]
}