The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDWB7",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/A",
"project": {
"title": "Biophysical analysis of an oligomerization-attenuated variant of the Leishmania donovani dynamin-1-like protein.",
"publication": {
"title": "Biophysical analysis of an oligomerization-attenuated variant of the Leishmania donovani dynamin-1-like protein.",
"author_list": "Wuyts E, Sundaramoorthy R, Tulloch L, Monsieurs P, Eadsforth TC, Pintelon I, Timmermans JP, Dujardin JC, Domagalska MA, Caljon G, De Rycker M, Postis VLG, Wyllie S, Sterckx YG",
"journal": "Mol Biochem Parasitol",
"doi": "10.1016/j.molbiopara.2025.111691",
"pmid": "40818547",
"published_date": "2025 Aug 14"
},
"status": "released",
"submitted_date": "2025-02-05",
"released_date": "2025-09-01"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDWB7.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDWB7.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDWB7_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDWB7_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDWB7_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDWB7_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDWB7.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Eiger 4M",
"resolution": 75.0
},
"name": "SOLEIL",
"city": "Saint-Aubin",
"country": "France",
"beamline_name": "SWING",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Dynamin central region family protein",
"short_name": null,
"sequence": "MDQLISVINELHDAFAGVKMNIKLNLPQIAVVGSQSCGKSSVLESIVGKDFLPRGSGIVTRCPLVLQLVQLPKSNEEEWGEFLHIPNKKFYDFNEIQNEITRRTIEMAGPSAITDKPISLKVYSNTVLNLTLVDLPGLVMNAVGDQPKDIDRQIKDMVTRYVSPKNTIILAISPANTDLATSQSLRLAKQLDPEGVRTVGVLTKIDLMDKGTDCFDVLQNKVLQLRHGFVGVVCRSQQDINDRKSMEAARRSEYEFFANSPIYSPIAEEAGTAYLSKKLNFLLLEHIKAVIPDLKRHVDQLMEATKKQMEKLGMFEQDITEPTAQLLYLIKLFSDTLNQTIDGGITDATKELLDGASLDYIFHECFATYVTSLSATKDLTDDYIRINTRNMAGMHATLFPSDQVFVALSKQQITRLEEPCIKCVTFVYEELTKIVEICAGKVDRYPNLKDAIISICKKMLLDYRLPTSTHVRTIIKAERGFINVKHPMMDELAQRAFANIYGTTNGDASSPPRNSSDPNASAAGSTQADPKQSGRDIKRDDRKDDKRGGRDEKRPEKSRDQGNADNVMSPGSKSDMNDVPSRIMLGKNMTMHEQYMNSAIREMVEGYFSIVKGNVADQVPKAITLLMITRLREEVYARLVSELYSDKTAKALLSEPPGIATQRKAAKEMLEALTKAQNALNSVRDYQLTKEPSSSMQAGALEVLFQGPGSGLNDIFEAQKIEWHEGRTKHHHHHHHH",
"organism": "Leishmania donovani",
"uniprot_code": "E9BL28",
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "dimer",
"molecular_type": "protein",
"uniprot_sequence": "MDQLISVINELHDAFAGVKMNIKLNLPQIAVVGSQSCGKSSVLESIVGKDFLPRGSGIVT\nRCPLVLQLVQLPKSNEEEWGEFLHIPNKKFYDFNEIQNEITRRTIEMAGPSAITDKPISL\nKVYSNTVLNLTLVDLPGLVMNAVGDQPKDIDRQIKDMVTRYVSPKNTIILAISPANTDLA\nTSQSLRLAKQLDPEGVRTVGVLTKIDLMDKGTDCFDVLQNKVLQLRHGFVGVVCRSQQDI\nNDRKSMEAARRSEYEFFANSPIYSPIAEEAGTAYLSKKLNFLLLEHIKAVIPDLKRHVDQ\nLMEATKKQMEKLGMFEQDITEPTAQLLYLIKLFSDTLNQTIDGGITDATKELLGGARLDY\nIFHECFATYVTSLSATKDLTDDYIRINTRNMAGMHATLFPSDQVFVALSKQQITRLEEPC\nIKCVTFVYEELTKIVEICAGKVDRYPNLKDAIISICKKMLLDYRLPTSTHVRTIIKAERG\nFINVKHPMMDELAQRAFANIYGTTNGDASSPPRNSSDPNASAAGSTQADPKQSGRDIKRD\nDRKDDKRGGRDEKRPEKSRDQGNADNVMSPGSKSDMNDVPSRIMLGKNMTMHEQYMNSAI\nREMVEGYFSIVKGNVADQVPKAITLLMITRLREEVYARLVSELYSDKTAKALLSEPPGIA\nTQRKAAKEMLEALTKAQNALNSVRDYQLTKEPSSSMQAGA",
"mw": 82.384,
"total_mw": 164.768,
"number_molecules": 2,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": ""
}
],
"buffer": {
"name": "20 mM HEPES, 200 mM NaCl, 3% glycerol",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.4,
"deuteration": null
},
"purity_method": null,
"name": "Dynamin central region family protein from Leishmania donovani DLP1 G354D / R357S",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": null,
"full_name": "University of Antwerp",
"webpage": null
}
],
"contributor_name": "Yann",
"contributor_surname": "Sterckx",
"orcid": "https://orcid.org/0000-0002-7420-0983"
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2024-04-04",
"storage_temperature": 20.0,
"cell_temperature": 20.0,
"exposure_time": 0.75,
"number_of_frames": 6848,
"wavelength": 0.099,
"sample_detector_distance": 2.0,
"concentration_min": null,
"concentration_max": 6.44,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.109,
"s_max": 3.503,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": null,
"software": "DENSS",
"pdb_link": [],
"model_title": null,
"type_of_model": "density",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDWB7_fit1_model1.mrc",
"model_mw": null,
"bead_radius": null,
"log": null,
"symmetry": "P2",
"comment": null,
"user": 488
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDWB7_fit1_fixed_fit_img.png",
"software": "DENSS",
"chi_square_value": null,
"p_value": 0.0,
"fit_residual_plot": null,
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDWB7_fit1.fit",
"fit_log": null,
"software_version": null,
"description": ""
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDWB7_fit2_model1_img.png",
"software": "BILBOMD",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDWB7_fit2_model1.pdb",
"model_mw": 164.2,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": null,
"user": 488
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDWB7_fit2_fitfoxs_img.png",
"software": "MultiFoXS",
"chi_square_value": 1.096298,
"p_value": 0.0221,
"fit_residual_plot": "SASDWB7_fit2_fitfoxsresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDWB7_fit2.dat",
"fit_log": null,
"software_version": null,
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": null,
"experiment_description": null,
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 163.5,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 151.0,
"porod_mw_error": null,
"pddf_i0": 0.02947,
"pddf_i0_error": null,
"guinier_i0": 0.028923,
"guinier_i0_error": null,
"pddf_rg": 7.0,
"pddf_rg_error": null,
"guinier_rg": 6.612,
"guinier_rg_error": 0.488,
"pddf_dmax": 24.95,
"pddf_dmax_error": null,
"porod_volume": 340.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 6,
"guinier_point_last": 20,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDWB7_datloglog_img.png",
"symmetry": null,
"last_modified": "2025-09-01T15:43:58.232969+02:00",
"bragg_peak": []
}
