The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDWE3",
"status": "Published",
"type_of_curve": "SEC-SAS",
"angular_unit": "1/A",
"project": {
"title": "Size-exclusion chromatography–small-angle neutron scattering system optimized for an instrument with medium neutron flux",
"publication": {
"title": "Size-exclusion chromatography–small-angle neutron scattering system optimized for an instrument with medium neutron flux",
"author_list": "Morishima K, Inoue R, Nakagawa T, Shimizu M, Sakamoto R, Oda T, Mayumi K, Sugiyama M",
"journal": "Journal of Applied Crystallography",
"doi": "10.1107/S1600576725000779",
"pmid": null,
"published_date": "2025 Feb 11"
},
"status": "released",
"submitted_date": "2024-12-09",
"released_date": "2025-02-12"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDWE3.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDWE3.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDWE3_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDWE3_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDWE3_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDWE3_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDWE3.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "3He position sensitive detector (PSD)",
"name": "ORDELA, model 2660N",
"resolution": 5.0
},
"name": "JRR-3 (Japan Atomic Energy Agency)",
"city": "Ibaraki",
"country": "Japan",
"beamline_name": "SANS-U",
"beam_geometry": null,
"type_of_source": "neutron source",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Circadian clock oscillator protein KaiB",
"short_name": "kaiB",
"sequence": "GPLGSMSPRKTYILKLYVAGNTPNSVRALKTLKNILEVEFQGVYALKVIDVLKNPQLAEEDKILATPTLAKVLPLPVRRIIGDLSDREKVLIGLDLLYGELQDSDDF",
"organism": "Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)",
"uniprot_code": "Q5N595",
"uniprot_range_first": 1,
"uniprot_range_last": 102,
"oligomerization": "hexamer",
"molecular_type": "protein",
"uniprot_sequence": "MSPRKTYILKLYVAGNTPNSVRALKTLKNILEVEFQGVYALKVIDVLKNPQLAEEDKILA\nTPTLAKVLPLPVRRIIGDLSDREKVLIGLDLLYGELQDSDDF",
"mw": 11.848,
"total_mw": 71.088,
"number_molecules": 6,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": "The protein construct contains an additional GPLGS N-terminal extension."
},
{
"long_name": "Circadian clock oscillator protein KaiC",
"short_name": "kaiC",
"sequence": "MASWSHPQFEKGATSAEMTSPNNNSEHQAIAKMRTMIEGFDDISHGGLPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVFVTFEETPQDIIKNARSFGWDLAKLVDEGKLFILDASPDPEGQEVVGGFDLSALIERINYAIQKYRARRVSIDSVTSVFQQYDASSVVRRELFRLVARLKQIGATTVMTTERIEEYGPIARYGVEEFVSDNVVILRNVLEGERRRRTLEILKLRGTSHMKGEYPFTITDHGINIFPLGAMRLTQRSSNVRVSSGVVRLDEMCGGGFFKDSIILATGATGTGKTLLVSRFVENACANKERAILFAYEESRAQLLRNAYSWGMDFEEMERQNLLKIVCAYPESAGLEDHLQIIKSEINDFKPARIAIDSLSALARGVSNNAFRQFVIGVTGYAKQEEITGLFTNTSDQFMGAHSITDSHISTITDTIILLQYVEIRGEMSRAINVFKMRGSWHDKAIREFMISDKGPDIKDSFRNFERIISGSPTRITVDEKSELSRIVRGVQEKGPES",
"organism": "Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)",
"uniprot_code": "Q79PF4",
"uniprot_range_first": 2,
"uniprot_range_last": 519,
"oligomerization": "hexamer",
"molecular_type": "protein",
"uniprot_sequence": "MTSAEMTSPNNNSEHQAIAKMRTMIEGFDDISHGGLPIGRSTLVSGTSGTGKTLFSIQFL\nYNGIIEFDEPGVFVTFEETPQDIIKNARSFGWDLAKLVDEGKLFILDASPDPEGQEVVGG\nFDLSALIERINYAIQKYRARRVSIDSVTSVFQQYDASSVVRRELFRLVARLKQIGATTVM\nTTERIEEYGPIARYGVEEFVSDNVVILRNVLEGERRRRTLEILKLRGTSHMKGEYPFTIT\nDHGINIFPLGAMRLTQRSSNVRVSSGVVRLDEMCGGGFFKDSIILATGATGTGKTLLVSR\nFVENACANKERAILFAYEESRAQLLRNAYSWGMDFEEMERQNLLKIVCAYPESAGLEDHL\nQIIKSEINDFKPARIAIDSLSALARGVSNNAFRQFVIGVTGYAKQEEITGLFTNTSDQFM\nGAHSITDSHISTITDTIILLQYVEIRGEMSRAINVFKMRGSWHDKAIREFMISDKGPDIK\nDSFRNFERIISGSPTRITVDEKSELSRIVRGVQEKGPES",
"mw": 59.329,
"total_mw": 355.974,
"number_molecules": 6,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": "The protein construct contains an additional MASWSHPQFEKGA N-terminal extension."
}
],
"buffer": {
"name": "50 mM sodium phosphate buffer, 150 mM NaCl, 5 mM MgCl₂, 0.5 mM EDTA, 1 mM ATP, 1 mM DTT, 50 mM arginine, 50 mM glutamine, in 100% D₂O",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.8,
"deuteration": null
},
"purity_method": null,
"name": "Cyanobacterial circadian clock protein KaiB-KaiC complex (71% deuterated-KaiB and hydrogenated-KaiC in 100% v/v D₂O ) measured by SEC-SANS",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": null,
"full_name": "Kyoto University",
"webpage": null
}
],
"contributor_name": "Ken",
"contributor_surname": "Morishima",
"orcid": "https://orcid.org/0000-0003-1091-3850"
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2024-07-02",
"storage_temperature": 10.0,
"cell_temperature": 25.0,
"exposure_time": 600.0,
"number_of_frames": 24,
"wavelength": 0.6,
"sample_detector_distance": 4.0,
"concentration_min": null,
"concentration_max": 6.8,
"sample_volume": 500.0,
"flow_rate": 0.0,
"s_min": 0.106,
"s_max": 3.972,
"total_exposure_time": null,
"seccolumn": 47
},
"fits": [],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": null,
"i0_calibration_standard": null,
"description": "SEC elution paused during SANS measurements.",
"experiment_description": "SANS data from solutions of the Cyanobacterial circadian clock protein KaiB-KaiC complex (71% deuterated-KaiB and hydrogenated-KaiC) in 50 mM sodium phosphate buffer, 150 mM NaCl, 5 mM MgCl₂, 0.5 mM EDTA, 1 mM ATP, 1 mM DTT, 50 mM arginine, 50 mM glutamine, 100% v/v D₂O, pH 7.8 were collected on the SANS-U beam line at JRR-3 (Japan Atomic Energy Agency; Ibaraki, Japan) using a ORDELA, model 2660N detector at a sample-detector distance of 4 and 1.03 m and at a wavelength of λ = 0.6 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). Stop-flow mode in-line size-exclusion chromatography (SEC) SAS was employed. The SEC parameters were as follows: A 500.00 μl sample at 6.8 mg/ml was injected onto a Cytiva Superdex 200 Increase 10/300 column at 25°C. 24 successive 600 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
"tags": [],
"intensity_unit": "1/cm",
"experimental_mw": 333.0,
"experimental_mw_error": null,
"guinier_i0_mw": 333.0,
"guinier_i0_mw_error": 10.0,
"porod_mw": null,
"porod_mw_error": null,
"pddf_i0": 0.536,
"pddf_i0_error": null,
"guinier_i0": 0.546858,
"guinier_i0_error": null,
"pddf_rg": 4.12,
"pddf_rg_error": null,
"guinier_rg": 4.32,
"guinier_rg_error": 0.06,
"pddf_dmax": 11.7,
"pddf_dmax_error": null,
"porod_volume": null,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 5,
"guinier_point_last": 20,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDWE3_datloglog_img.png",
"symmetry": null,
"last_modified": "2025-02-12T13:44:34.496707+01:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDWE3",
"status": "success",
"started_at": "2026-08-11T13:58:47.134260+00:00",
"finished_at": "2026-08-11T13:58:53.456854+00:00",
"source_last_modified": "2025-02-12T13:44:34.496707+01:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDWE3/",
"path": "/data/saxsdb/sasbdb/entries/e3/sasdwe3/source/summary.json",
"size": 8691,
"sha256": "8f94c7cccc35f54a86a4e5d8208eb911ce4425488d3d694a81518d2d7290f158"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDWE3.dat",
"path": "/data/saxsdb/sasbdb/entries/e3/sasdwe3/source/SASDWE3.dat",
"size": 4784,
"sha256": "2a4345382f16c9a522543a231d474ab6a5cee9a5748ab07566638f60d909d2aa",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDWE3.out",
"path": "/data/saxsdb/sasbdb/entries/e3/sasdwe3/source/SASDWE3.out",
"size": 11041,
"sha256": "802012b9a3f77cd32e8ea9e6751d7ebb846259482a7f82c13ff615babd16d9d2",
"role": "pddf"
},
{
"status": "not_available",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDWE3.sascif",
"path": "/data/saxsdb/sasbdb/entries/e3/sasdwe3/source/SASDWE3.sascif",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDWE3.zip",
"path": "/data/saxsdb/sasbdb/entries/e3/sasdwe3/source/SASDWE3.zip",
"size": 5682,
"sha256": "db973859ff1258e5932fadb03dca6d9258ff87a4a58d4354ca30f24afa990e28",
"role": "full_entry_zip",
"zip_member_count": 2,
"zip_validation": "central_directory_readable"
}
]
}
