The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDWF9",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/nm",
"project": {
"title": "KDSAXS: A tool for Analyzing Binding Equilibria with SAXS Data using Explicit Models",
"publication": {
"title": "KDSAXS: A tool for Analyzing Binding Equilibria with SAXS Data using Explicit Models",
"author_list": "Gomes T, Ruiz L, Martin-Malpartida P, Bernadó P, Baptista A, Macias M, Cordeiro T",
"journal": "Journal of Molecular Biology",
"doi": "10.1016/j.jmb.2025.169103",
"pmid": null,
"published_date": "2025 Mar"
},
"status": "released",
"submitted_date": "2025-03-02",
"released_date": "2025-03-28"
},
"pddf_data": null,
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDWF9.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDWF9_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDWF9_kratky_img.png",
"pddf_plot": null,
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDWF9_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDWF9.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus 2M",
"resolution": null
},
"name": "PETRA III",
"city": "DESY; Hamburg",
"country": "Germany",
"beamline_name": "EMBL P12",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Proliferating cell nuclear antigen",
"short_name": "PCNA",
"sequence": "GPHMFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTY\r\nRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMD\r\nLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNI\r\nKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYK\r\nIADMGHLKYYLAPKIEDEEGS",
"organism": "Homo sapiens",
"uniprot_code": "P12004",
"uniprot_range_first": 1,
"uniprot_range_last": 261,
"oligomerization": "trimer",
"molecular_type": "protein",
"uniprot_sequence": "MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTY\nRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMD\nLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNI\nKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYK\nIADMGHLKYYLAPKIEDEEGS",
"mw": 29.06,
"total_mw": 87.18,
"number_molecules": 3,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": "The protein construct used for SAXS contains an additional three non-native amino acids at the N-terminus (GPH)."
},
{
"long_name": "PCNA-associated factor",
"short_name": "p15",
"sequence": "VRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPK\r\nWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE",
"organism": "Homo sapiens",
"uniprot_code": "Q15004",
"uniprot_range_first": 2,
"uniprot_range_last": 111,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPK\nWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE",
"mw": 11.855,
"total_mw": 11.855,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": "Disordered protein."
}
],
"buffer": {
"name": "137 mM NaCl, 2.7 mM KCl, 10 mM sodium phosphate, 2 mM potassium phosphate (PBS)",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.0,
"deuteration": null
},
"purity_method": null,
"name": "Proliferating cell nuclear antigen:PCNA-associated factor (PCNA:P15) titration, 150 µM:370 µM",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "Oeiras, Portugal",
"full_name": "Instituto de Tecnologia Química e Biológica António Xavier, Universidade de Lisboa",
"webpage": "http://www.itqb.unl.pt"
}
],
"contributor_name": "Tiago",
"contributor_surname": "Cordeiro",
"orcid": "https://orcid.org/0000-0003-2663-3220"
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2012-04-23",
"storage_temperature": 10.0,
"cell_temperature": 25.0,
"exposure_time": null,
"number_of_frames": null,
"wavelength": 0.124,
"sample_detector_distance": 3.0,
"concentration_min": 1.3,
"concentration_max": 20.0,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.508,
"s_max": 5.0,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [],
"estimated_volume_method": null,
"pddf_software": null,
"pddf_software_version": null,
"i0_calibration_standard": null,
"description": "The Rg and the MW are not properly estimated as the profile has been truncated to avoid interparticle interactions. This is a profile from a titration series.",
"experiment_description": null,
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 109.0,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 117.0,
"porod_mw_error": null,
"pddf_i0": null,
"pddf_i0_error": null,
"guinier_i0": 72.9836,
"guinier_i0_error": null,
"pddf_rg": null,
"pddf_rg_error": null,
"guinier_rg": 3.667,
"guinier_rg_error": 0.092,
"pddf_dmax": 11.0,
"pddf_dmax_error": null,
"porod_volume": 187.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 1,
"guinier_point_last": 10,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDWF9_datloglog_img.png",
"symmetry": null,
"last_modified": "2025-03-28T13:54:53.565877+01:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDWF9",
"status": "success",
"started_at": "2026-08-11T16:13:59.906836+00:00",
"finished_at": "2026-08-11T16:14:05.760610+00:00",
"source_last_modified": "2025-03-28T13:54:53.565877+01:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDWF9/",
"path": "/data/saxsdb/sasbdb/entries/f9/sasdwf9/source/summary.json",
"size": 6935,
"sha256": "350fdf5b8a72fbf78bcb2e0f03d8626238e66190e13f354b6fb24753f4b00ea0"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDWF9.dat",
"path": "/data/saxsdb/sasbdb/entries/f9/sasdwf9/source/SASDWF9.dat",
"size": 72292,
"sha256": "4a11d10d9eaf200a36d595e2cc7d37445439304660a0e01125f9ee9506633fbc",
"role": "curve"
},
{
"role": "pddf",
"status": "not_listed",
"path": "/data/saxsdb/sasbdb/entries/f9/sasdwf9/source/SASDWF9.out"
},
{
"status": "not_available",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDWF9.sascif",
"path": "/data/saxsdb/sasbdb/entries/f9/sasdwf9/source/SASDWF9.sascif",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDWF9.zip",
"path": "/data/saxsdb/sasbdb/entries/f9/sasdwf9/source/SASDWF9.zip",
"size": 19173,
"sha256": "c5376616d74c664074248076cafcd8b1cb280f43009954f63fbaecb71c67a464",
"role": "full_entry_zip",
"zip_member_count": 1,
"zip_validation": "central_directory_readable"
}
]
}
