The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDWK7",
"status": "Published",
"type_of_curve": "SEC-SAS",
"angular_unit": "1/nm",
"project": {
"title": "Conformational multiplicity of bacterial ferric binding protein revealed by small angle x-ray scattering and molecular dynamics calculations",
"publication": {
"title": "Conformational multiplicity of bacterial ferric binding protein revealed by small angle x-ray scattering and molecular dynamics calculations",
"author_list": "Liu G, Ekmen E, Jalalypour F, Mertens H, Jeffries C, Svergun D, Atilgan A, Atilgan C, Sayers Z",
"journal": "The Journal of Chemical Physics",
"doi": "10.1063/5.0136558",
"pmid": null,
"published_date": "2023 Feb 24"
},
"status": "released",
"submitted_date": "2025-02-13",
"released_date": "2025-07-28"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDWK7.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDWK7.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDWK7_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDWK7_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDWK7_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDWK7_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDWK7.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus 6M",
"resolution": null
},
"name": "PETRA III",
"city": "DESY; Hamburg",
"country": "Germany",
"beamline_name": "EMBL P12",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Iron-utilization periplasmic protein",
"short_name": "FBPA_HAEIN",
"sequence": "SDITVYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPAAVFYTEQTATFADLSEAGLLAPISEQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSEKDMEKSVLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKLYAKNSVALQAVENGEVPAALINNYYWYNLAKEKGVENLKSRLYFVRHQDPGALVSYSGAAVLKASKNQAEAQKFVDFLASKKGQEALVAARAEYPLRADVVSPFNLEPYEKLEAPVVSATTAQDKEHAIKLIEEAGLK",
"organism": "Haemophilus influenzae",
"uniprot_code": "P35755",
"uniprot_range_first": 23,
"uniprot_range_last": 332,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MQFKHFKLATLAAALAFSANSFADITVYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQ\nLAGQLKEEGDKTPADVFYTEQTATFADLSEAGLLAPISEQTIQQTAQKGVPLAPKKDWIA\nLSGRSRVVVYDHTKLSEKDMEKSVLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKV\nALNWLKGLKENGKLYAKNSVALQAVENGEVPAALINNYYWYNLAKEKGVENLKSRLYFVR\nHQDPGALVSYSGAAVLKASKNQAEAQKFVDFLASKKGQEALVAARAEYPLRADVVSPFNL\nEPYEKLEAPVVSATTAQDKEHAIKLIEEAGLK",
"mw": 33.768,
"total_mw": 33.768,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "10 mM Na2HPO4 . 7H2O 1.8 mM KH2PO4 137 mM NaCl 2.7 mM KCl 5% v/v Glycerol",
"concentration_unit": null,
"comment": "PBS buffer",
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.4,
"deuteration": null
},
"purity_method": null,
"name": "D52A mutant of ferric binding protein (FbpA) in holo (with Fe) form in high ionic strength (HIS) buffer (PBS)",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": null,
"full_name": "Sabanci University",
"webpage": null
}
],
"contributor_name": "Goksin",
"contributor_surname": "Liu",
"orcid": ""
},
{
"affiliation": [
{
"short_name": null,
"address": null,
"full_name": "Sabanci University",
"webpage": null
}
],
"contributor_name": "Zehra",
"contributor_surname": "Sayers",
"orcid": ""
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2019-12-09",
"storage_temperature": 4.0,
"cell_temperature": 10.0,
"exposure_time": 0.995,
"number_of_frames": 3600,
"wavelength": 0.123987,
"sample_detector_distance": 3.0,
"concentration_min": null,
"concentration_max": 14.4,
"sample_volume": 75.0,
"flow_rate": 0.5,
"s_min": 0.089,
"s_max": 7.289,
"total_exposure_time": null,
"seccolumn": 1
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDWK7_fit1_model1_img.png",
"software": "DAMMIN",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDWK7_fit1_model1.pdb",
"model_mw": 21.979,
"bead_radius": 1.75,
"log": null,
"symmetry": null,
"comment": null,
"user": 548
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDWK7_fit1_fixed_fit_img.png",
"software": "DAMMIN",
"chi_square_value": 1.112,
"p_value": 0.0106,
"fit_residual_plot": "SASDWK7_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDWK7_fit1.fir",
"fit_log": null,
"software_version": null,
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": null,
"experiment_description": null,
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 32.223,
"experimental_mw_error": null,
"guinier_i0_mw": 29754.0,
"guinier_i0_mw_error": null,
"porod_mw": 24.3,
"porod_mw_error": null,
"pddf_i0": 7077.0,
"pddf_i0_error": null,
"guinier_i0": 7088.82,
"guinier_i0_error": 3.38,
"pddf_rg": 1.976,
"pddf_rg_error": null,
"guinier_rg": 1.993,
"guinier_rg_error": 0.002,
"pddf_dmax": 5.86,
"pddf_dmax_error": null,
"porod_volume": 33.3,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 9,
"guinier_point_last": 204,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDWK7_datloglog_img.png",
"symmetry": null,
"last_modified": "2025-11-23T16:41:54.737508+01:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDWK7",
"status": "success",
"started_at": "2026-08-11T15:32:31.225438+00:00",
"finished_at": "2026-08-11T15:32:40.182851+00:00",
"source_last_modified": "2025-11-23T16:41:54.737508+01:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDWK7/",
"path": "/data/saxsdb/sasbdb/entries/k7/sasdwk7/source/summary.json",
"size": 7387,
"sha256": "90bb75c18c17aacdccaa589bada8d47ee6fdf1117d9da278aa3604c5a0443820"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDWK7.dat",
"path": "/data/saxsdb/sasbdb/entries/k7/sasdwk7/source/SASDWK7.dat",
"size": 123951,
"sha256": "c34ed92f4cc6d8fa2f76dae723b49ece5c2562c98a1955f8fc0e680406c62526",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDWK7.out",
"path": "/data/saxsdb/sasbdb/entries/k7/sasdwk7/source/SASDWK7.out",
"size": 121173,
"sha256": "85536edb2b0ffec66c093b6ac5ed97856ce0d4390d382cb9c4f9352e82a4b7f5",
"role": "pddf"
},
{
"status": "not_available",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDWK7.sascif",
"path": "/data/saxsdb/sasbdb/entries/k7/sasdwk7/source/SASDWK7.sascif",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDWK7.zip",
"path": "/data/saxsdb/sasbdb/entries/k7/sasdwk7/source/SASDWK7.zip",
"size": 99334,
"sha256": "3eb2007db670c324587ca243bef7c089928b2621c802c9fc54ed0730c94c0568",
"role": "full_entry_zip",
"zip_member_count": 4,
"zip_validation": "central_directory_readable"
}
]
}
