The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDWM8",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/A",
"project": {
"title": "Clocked stepping of an artificial protein walker along a DNA track.",
"publication": {
"title": "Clocked stepping of an artificial protein walker along a DNA track.",
"author_list": "Nilsson P, Robertson NO, Gustafsson N, Davies RB, Liew CW, Lyons A, Eichhorn R, Niman CS, Blab GA, Bromley EHC, Whitten AE, Duff AP, Unksov IN, Beech JP, Jönsson P, Böcking T, Höcker B, Woolfson DN, Forde NR, Linke H, Curmi PMG",
"journal": "Nat Nanotechnol",
"doi": "10.1038/s41565-026-02211-3",
"pmid": "42410215",
"published_date": "2026 Jul 6"
},
"status": "released",
"submitted_date": "2025-02-20",
"released_date": "2026-02-20"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDWM8.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDWM8.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDWM8_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDWM8_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDWM8_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDWM8_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDWM8.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus3 S 2M",
"resolution": 172.0
},
"name": "Australian Synchrotron",
"city": "Melbourne",
"country": "Australia",
"beamline_name": "SAXS/WAXS",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Tumbleweed",
"short_name": "TW",
"sequence": "GKDLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEADRWEHVMSDEVERRLVKVLKGSSGG\r\n\r\nSGTLYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAQGSSGGSGSSGDSATHIKFSKRDEDGKELAGATMELRDSSGKTISTWISDGQVKDFYLYPGKYTFVETAAPDGYEVATAITFTVNEQGQVTVNGKATKGDAHISGTLYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAQGSSGGSGSSGDSATHIKFSKRDEDGKELAGATMELRDSSGKTISTWISDGQVKDFYLYPGKYTFVETAAPDGYEVATAITFTVNEQGQVTVNGKATKGDAHI\r\n\r\nGAQQSPYSAAMAEQRHQEWLRFVDLLKNAYQNDLHLPLLNLMLTPDEREALGTRVRIVEELLRGEMSQRELKNELGAGIATITRGSNSLKAAPVELRQWLEEVLLKSDGSSGGSGTLYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAQGSSGGSGSSGAHIVMVDAYKPTKGSSG\r\n\r\nSGSSGAHIVMVDAYKPTKGSSGGSGSSGTLYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAQGSSGGSGGAEWSGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRKVNNLRHATNSELLCEAFLHAFTGQPLPDDADLRKERSDEIPEAAKEIMREMGINPETWEY\r\n\r\nSGTLYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAQGSS\r\n\r\nGSSGTLYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAQGSS\r\n\r\nGKDLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEADRWEHVMSDEVERRLVKVLKGSS\r\n\r\nGAQQSPYSAAMAEQRHQEWLRFVDLLKNAYQNDLHLPLLNLMLTPDEREALGTRVRIVEELLRGEMSQRELKNELGAGIATITRGSNSLKAAPVELRQWLEEVLLKSDGSS\r\n\r\nSGGAEWSGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRKVNNLRHATNSELLCEAFLHAFTGQPLPDDADLRKERSDEIPEAAKEIMREMGINPETWEY",
"organism": "synthetic construct",
"uniprot_code": null,
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "",
"mw": 132.785,
"total_mw": 132.785,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": "TW protein composed of constructs TW1 and TW2 linked covalently via SpyTag/SpyCatcher"
}
],
"buffer": {
"name": "10 mM HEPES, 150 mM NaCl, 5mM MgCl2",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.4,
"deuteration": null
},
"purity_method": null,
"name": "Tumbleweed protein composed of synthetic constructs TW1 and TW2 linked covalently via SpyTag/SpyCatcher",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "ANSTO",
"address": "Kirrawee DC, NSW 2232, Australia",
"full_name": "Australian Nuclear Science and Technology Organisation",
"webpage": ""
}
],
"contributor_name": "Andrew",
"contributor_surname": "Whitten",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2023-03-15",
"storage_temperature": 10.0,
"cell_temperature": 20.0,
"exposure_time": 1.0,
"number_of_frames": 10,
"wavelength": 0.10332,
"sample_detector_distance": 2.68,
"concentration_min": null,
"concentration_max": 10.0,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.047,
"s_max": 4.92,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDWM8_fit1_model1_img.png",
"software": "MultiFoXS",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDWM8_fit1_model1.pdb",
"model_mw": 132.7,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": "72.5% of ensemble",
"user": 111
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDWM8_fit1_fixed_fit_img.png",
"software": "FoXS",
"chi_square_value": 1.5624,
"p_value": 0.1564,
"fit_residual_plot": "SASDWM8_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDWM8_fit1.fit",
"fit_log": null,
"software_version": null,
"description": "Ensemble fit composed of 2 conformations"
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDWM8_fit2_model1_img.png",
"software": "MultiFoXS",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDWM8_fit2_model1.pdb",
"model_mw": 132.7,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": "27.5% of ensemble",
"user": 111
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDWM8_fit2_fixed_fit_img.png",
"software": "FoXS",
"chi_square_value": 1.5624,
"p_value": 0.1564,
"fit_residual_plot": "SASDWM8_fit2_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDWM8_fit2.fit",
"fit_log": null,
"software_version": null,
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "4.6",
"i0_calibration_standard": null,
"description": "TW is a protein formed by covalent linkage of the the proteins TW1 and TW2 via a SpyTag/SpyCatcher. SAXS data was collected at the SAXS/WAXS beamline at the Australian Synchrotron, with Pilatus 2M detector at a SDD of 2680mm, with an incident intensity of ~8 x 10^12 ph/s. A SEC-SAXS setup with sheath flow was used. The running buffer was 10 mM HEPES pH 7.4, 150 mM NaCl, 5mM MgCl2, and 50uL of sample at ~10mg/mL was injected onto a Superdex 200 Increase 5/150 GL running at 0.2mL/min. Buffer scattering frames taken immediately before the void fraction. Sample scattering frames taken at the elution peak over a region of stable Rg using CHROMIX. Data were fit by a 2-state model using MultiFoXS.",
"experiment_description": null,
"tags": [],
"intensity_unit": "1/cm",
"experimental_mw": 156.0,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 156.0,
"porod_mw_error": null,
"pddf_i0": 0.06177,
"pddf_i0_error": 0.00015,
"guinier_i0": 0.0613714,
"guinier_i0_error": null,
"pddf_rg": 6.91,
"pddf_rg_error": 0.04,
"guinier_rg": 6.659,
"guinier_rg_error": 0.266,
"pddf_dmax": 27.0,
"pddf_dmax_error": 1.0,
"porod_volume": 190.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 4,
"guinier_point_last": 41,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDWM8_datloglog_img.png",
"symmetry": null,
"last_modified": "2026-07-07T15:34:42.237325+02:00",
"bragg_peak": []
}
