The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDWM9",
"status": "Published",
"type_of_curve": "SEC-SAS",
"angular_unit": "1/nm",
"project": {
"title": "Staufen-swapping motif is crucial for Staufen dimerization, structure, and Staufen-mediated mRNA decay.",
"publication": {
"title": "Staufen-swapping motif is crucial for Staufen dimerization, structure, and Staufen-mediated mRNA decay.",
"author_list": "Tripepi A, Shakoor H, Zlobina M, Klumpler T, Kubíčková M, Houser J, Klapetek P, Lukavsky PJ",
"journal": "Protein Sci",
"doi": "10.1002/pro.70669",
"pmid": "42300088",
"published_date": "2026 Jul"
},
"status": "released",
"submitted_date": "2025-02-28",
"released_date": "2026-06-20"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDWM9.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDWM9.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDWM9_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDWM9_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDWM9_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDWM9_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDWM9.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus 6M",
"resolution": null
},
"name": "PETRA III",
"city": "DESY; Hamburg",
"country": "Germany",
"beamline_name": "EMBL P12",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Double-stranded RNA-binding protein Staufen homolog 1 (178-577)",
"short_name": "dsRBD3-End",
"sequence": "GSHMEENLNKSEISQVFEIALKRNLPVNFEVARESGPPHMKNFVTKVSVGEFVGEGEGKSKKISKKNAAIAVLEELKKLPPLPAVERVKPRIKKKTKPIVKPQTSPEYGQGINPISRLAQIQQAKKEKEPEYTLLTERGLPRRREFVMQVKVGNHTAEGTGTNKKVAKRNAAENMLEILGFKVPQAQPTKPALKSEEKTPIKKPGDGRKVTFFEPGSGDENGTSNKEDEFRMPYLSHQQLPAGILPMVPEVAQAVGVSQGHHTKDFTRAAPNPAKATVTAMIARELLYGGTSPTAETILKNNISSGHVPHGPLTRPSEQLDYLSRVQGFQVEYKDFPKNNKNEFVSLINCSSQPPLISHGIGKDVESCHDMAALNILKLLSELDQQSTEMPRTGNGPMSVCGRC",
"organism": "Homo sapiens",
"uniprot_code": "O95793",
"uniprot_range_first": 178,
"uniprot_range_last": 577,
"oligomerization": "other",
"molecular_type": "protein",
"uniprot_sequence": "MSQVQVQVQNPSAALSGSQILNKNQSLLSQPLMSIPSTTSSLPSENAGRPIQNSALPSAS\nITSTSAAAESITPTVELNALCMKLGKKPMYKPVDPYSRMQSTYNYNMRGGAYPPRYFYPF\nPVPPLLYQVELSVGGQQFNGKGKTRQAAKHDAAAKALRILQNEPLPERLEVNGRESEEEN\nLNKSEISQVFEIALKRNLPVNFEVARESGPPHMKNFVTKVSVGEFVGEGEGKSKKISKKN\nAAIAVLEELKKLPPLPAVERVKPRIKKKTKPIVKPQTSPEYGQGINPISRLAQIQQAKKE\nKEPEYTLLTERGLPRRREFVMQVKVGNHTAEGTGTNKKVAKRNAAENMLEILGFKVPQAQ\nPTKPALKSEEKTPIKKPGDGRKVTFFEPGSGDENGTSNKEDEFRMPYLSHQQLPAGILPM\nVPEVAQAVGVSQGHHTKDFTRAAPNPAKATVTAMIARELLYGGTSPTAETILKNNISSGH\nVPHGPLTRPSEQLDYLSRVQGFQVEYKDFPKNNKNEFVSLINCSSQPPLISHGIGKDVES\nCHDMAALNILKLLSELDQQSTEMPRTGNGPMSVCGRC",
"mw": 44.387,
"total_mw": 44.387,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": "Human Double-stranded RNA-binding protein Staufen homolog 1 with truncated RNA-binding domain 2. The protein construct used for SAXS contains an additional four non-native amino acids at the N-terminus (GSHM)."
}
],
"buffer": {
"name": "50 mM Tris-HCl, 150 mM NaCl, 3.6 mM β-mercaptoethanol",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 8.0,
"deuteration": null
},
"purity_method": null,
"name": "Human Double-stranded RNA-binding protein Staufen homolog 1 with truncated RNA-binding domain 2",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": null,
"full_name": "CEITEC - Central European Institute of Technology, Masaryk University",
"webpage": "https://www.ceitec.eu/"
}
],
"contributor_name": "Tomas",
"contributor_surname": "Klumpler",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2021-04-23",
"storage_temperature": 4.0,
"cell_temperature": 20.0,
"exposure_time": 1.0,
"number_of_frames": 45,
"wavelength": 0.123983,
"sample_detector_distance": 3.0,
"concentration_min": null,
"concentration_max": 10.4,
"sample_volume": 100.0,
"flow_rate": 0.7,
"s_min": 0.092,
"s_max": 4.001,
"total_exposure_time": null,
"seccolumn": 1
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDWM9_fit1_model1_img.png",
"software": "EOM/RANCH",
"pdb_link": [],
"model_title": null,
"type_of_model": "mix",
"software_version": "ATSAS 2.8.4",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDWM9_fit1_model1.pdb",
"model_mw": 43.92,
"bead_radius": 1.9,
"log": "https://www.sasbdb.org/media/log_files/logFile_001_1_oeMwsLV.log",
"symmetry": null,
"comment": null,
"user": 195
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDWM9_fit1_model2_img.png",
"software": "EOM/RANCH",
"pdb_link": [],
"model_title": null,
"type_of_model": "mix",
"software_version": "ATSAS 2.8.4",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDWM9_fit1_model2.pdb",
"model_mw": 86.69,
"bead_radius": 1.9,
"log": "https://www.sasbdb.org/media/log_files/logFile_001_1_X4ufjZg.log",
"symmetry": null,
"comment": null,
"user": 195
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDWM9_fit1_fixed_fit_img.png",
"software": "EOM/GAJOE",
"chi_square_value": 0.975,
"p_value": 0.9339,
"fit_residual_plot": "SASDWM9_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDWM9_fit1.fit",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/logFile_001_1_0nXrmoS.log",
"software_version": "ATSAS 2.8.4",
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": null,
"experiment_description": "Synchrotron SAXS data from solutions of Human Double-stranded RNA-binding protein Staufen homolog 1 with truncated RNA-binding domain 2 in 50 mM Tris-HCl, 150 mM NaCl, 3.6 mM β-mercaptoethanol, pH 8 were collected on the EMBL P12 beam line at PETRA III (DESY; Hamburg, Germany) using a Pilatus 6M detector at a sample-detector distance of 3 m and at a wavelength of λ = 0.123983 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). In-line size-exclusion chromatography (SEC) SAS was employed. The SEC parameters were as follows: A 100.00 μl sample at 10.4 mg/ml was injected at a 0.70 ml/min flow rate onto a GE Superdex 200 Increase 10/300 column at 20°C. 45 successive 1 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 44.7,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 55.5,
"porod_mw_error": null,
"pddf_i0": 2198.0,
"pddf_i0_error": null,
"guinier_i0": 2220.77,
"guinier_i0_error": null,
"pddf_rg": 4.621,
"pddf_rg_error": null,
"guinier_rg": 4.6,
"guinier_rg_error": 0.036,
"pddf_dmax": 13.7,
"pddf_dmax_error": null,
"porod_volume": 88.8,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 2,
"guinier_point_last": 69,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDWM9_datloglog_img.png",
"symmetry": null,
"last_modified": "2026-06-20T15:51:34.111789+02:00",
"bragg_peak": []
}
