The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDWT6",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/A",
"project": {
"title": "Nanobodies as tools for studying human frataxin biology.",
"publication": {
"title": "Nanobodies as tools for studying human frataxin biology.",
"author_list": "Pignataro MF, Fernández NB, Garay-Alvarez A, Pavan MF, Molina R, Muñoz IG, Grossi J, Noguera M, Vila A, García AE, Gentili HG, Rodríguez NA, Aran M, Parreño V, Bok M, Hermoso JA, Ibañez LI, Santos J",
"journal": "Commun Biol",
"doi": "10.1038/s42003-025-09458-x",
"pmid": "41484353",
"published_date": "2026 Jan 3"
},
"status": "released",
"submitted_date": "2025-01-27",
"released_date": "2026-01-05"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDWT6.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDWT6.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDWT6_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDWT6_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDWT6_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDWT6_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDWT6.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Eiger 4M",
"resolution": 75.0
},
"name": "Diamond Light Source",
"city": "Didcot",
"country": "UK",
"beamline_name": "B21",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Frataxin, mitochondrial",
"short_name": "FXN",
"sequence": "MLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA",
"organism": "Homo sapiens",
"uniprot_code": "Q16595",
"uniprot_range_first": 90,
"uniprot_range_last": 210,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRGLRTDIDATCTPRRASSNQR\nGLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTF\nEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGV\nSLHELLAAELTKALKTKLDLSSLAYSGKDA",
"mw": 13.605,
"total_mw": 13.605,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": "Fraxatin is a protein involved in iron homeostasis inside the mitochondria, belongs to a Cysteine desulfurase supercomplex and its related to Friedreich Ataxia disease."
},
{
"long_name": "Nanobody 16C10",
"short_name": "16C10",
"sequence": "QVQLQESGGGLVQPGGSLRLSCAATGSIFSINNMGWYRQPPGKGRHLVARLNDDGSTNYADSVKGRFTISRDNAKNTLYLQMNSLKPEDTAVYYCNAVPPIVTVNATDYWGQGTQVTVSSAAAYPYDVPDYGSHHHHHH",
"organism": "synthetic construct",
"uniprot_code": null,
"uniprot_range_first": 1,
"uniprot_range_last": 139,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "",
"mw": 15.137,
"total_mw": 15.137,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": "16C10 is a nanobody designed to stabilize the iron-binding protein frataxin, acting as a chaperone in Friedreich's ataxia disease. The protein construct used for SAS contains an additional C-terminal polyhistidine tag."
}
],
"buffer": {
"name": "20 mM Tris, 150 mM NaCl",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.5,
"deuteration": null
},
"purity_method": null,
"name": "Frataxin bound to tailored nanobody 16C10",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": null,
"full_name": "Spanish National Cancer Research Centre (CNIO)",
"webpage": null
}
],
"contributor_name": "INÉS",
"contributor_surname": "MUÑOZ",
"orcid": "https://orcid.org/0000-0001-6732-4059"
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2024-09-18",
"storage_temperature": 4.0,
"cell_temperature": 18.0,
"exposure_time": 3.0,
"number_of_frames": 600,
"wavelength": 0.1,
"sample_detector_distance": 3.7,
"concentration_min": null,
"concentration_max": 7.0,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.045,
"s_max": 3.399,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDWT6_fit1_model1_img.png",
"software": "DAMMIN",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDWT6_fit1_model1.pdb",
"model_mw": 23.824,
"bead_radius": 2.25,
"log": "https://www.sasbdb.org/media/log_files/1_OpBke4V.log",
"symmetry": "P1",
"comment": null,
"user": 973
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDWT6_fit1_fixed_fit_img.png",
"software": "FoXS",
"chi_square_value": 0.780894,
"p_value": 0.0024,
"fit_residual_plot": "SASDWT6_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDWT6_fit1.fit",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/1_vAcEslh.log",
"software_version": null,
"description": ""
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDWT6_fit2_model1_img.png",
"software": "Coot",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDWT6_fit2_model1.pdb",
"model_mw": 26.59,
"bead_radius": null,
"log": null,
"symmetry": "P1",
"comment": null,
"user": 973
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDWT6_fit2_fixed_fit_img.png",
"software": "FoXS",
"chi_square_value": 3.415012,
"p_value": 0.0,
"fit_residual_plot": "SASDWT6_fit2_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDWT6_fit2.fit",
"fit_log": null,
"software_version": null,
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": null,
"experiment_description": "Synchrotron SAXS data from solutions of Frataxin bound to tailored nanobody 16C10 in 20 mM Tris, 150 mM NaCl, pH 7.5 were collected on the B21 beam line at the Diamond Light Source (Didcot, UK) using a Eiger 4M detector at a sample-detector distance of 3.7 m and at a wavelength of λ = 0.1 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). One solute concentration of 7.00 mg/ml was measured at 18°C. 600 successive 3 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 26.63,
"experimental_mw_error": null,
"guinier_i0_mw": 26.34,
"guinier_i0_mw_error": null,
"porod_mw": 22.9,
"porod_mw_error": null,
"pddf_i0": 0.03377,
"pddf_i0_error": null,
"guinier_i0": 0.0337852,
"guinier_i0_error": null,
"pddf_rg": 2.41,
"pddf_rg_error": 0.03,
"guinier_rg": 2.388,
"guinier_rg_error": 0.044,
"pddf_dmax": 8.0,
"pddf_dmax_error": null,
"porod_volume": 36.6,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 67,
"guinier_point_last": 368,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDWT6_datloglog_img.png",
"symmetry": null,
"last_modified": "2026-01-05T09:09:29.795121+01:00",
"bragg_peak": []
}
