crTPpart2 of cysteine synthase A (CysK)

{
  "code": "SASDWW3",
  "status": "Published",
  "type_of_curve": "Extrapolated to infinite dilution",
  "angular_unit": "1/nm",
  "project": {
    "title": "The <i>Paulinella</i>\n              chromatophore transit peptide part2 adopts a structural fold similar to the γ-glutamyl-cyclotransferase fold",
    "publication": {
      "title": "The <i>Paulinella</i>\n              chromatophore transit peptide part2 adopts a structural fold similar to the γ-glutamyl-cyclotransferase fold",
      "author_list": "Klimenko V, Reiners J, Applegate V, Reimann K, Popowicz G, Hoeppner A, Papadopoulos A, Smits S, Nowack E",
      "journal": "Plant Physiology",
      "doi": "10.1093/plphys/kiaf504",
      "pmid": null,
      "published_date": "2025 Oct 10"
    },
    "status": "released",
    "submitted_date": "2024-12-04",
    "released_date": "2025-10-13"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDWW3.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDWW3.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDWW3_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDWW3_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDWW3_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDWW3_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDWW3.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": null,
        "name": "Pilatus 6M",
        "resolution": null
      },
      "name": "PETRA III",
      "city": "DESY; Hamburg",
      "country": "Germany",
      "beamline_name": "EMBL P12",
      "beam_geometry": null,
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "crTPpart2 of cysteine synthase A (CysK)",
          "short_name": "crTPpart2_CysK",
          "sequence": "GATSSSISAGGAAGADSSFIPKIGVNAVVARPNPPGPLQLLPPGISSPATLFIYPSMESLLGKDFGNGATSESAWVYGAKLTSDEAGALPVLTGQPSDVLKGRLVSFPPMGFPSKLRLVDGLMNFGGLSTTLREMVPVVKKDGSTIDTYWYYQ",
          "organism": "Paulinella chromatophora",
          "uniprot_code": null,
          "uniprot_range_first": null,
          "uniprot_range_last": null,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "",
          "mw": 15.821,
          "total_mw": 15.821,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": "No UniProt ID is available. This sequence was derived from the transcripts (GenBank: GEZN00000000.1,  Nowack, E. C. M., Price, D. C., Bhattacharya, D., Singer, A., Melkonian, M. and Grossman, A. R. (2016) Gene transfers from diverse bacteria compensate for reductive genome evolution in the chromatophore of Paulinella chromatophora. Proc. Nati. Acad. Sci. USA, 113, 12214-12219.) Scaffold4337-size1989, encoding a protein annotated as cysteine synthase A (CysK)."
        }
      ],
      "buffer": {
        "name": "20 mM HEPES, 300 mM NaCl",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 8.0,
        "deuteration": null
      },
      "purity_method": null,
      "name": "crTPpart2 of cysteine synthase A (CysK)",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": "Düsseldorf, Germany",
            "full_name": "Heinrich Heine University Düsseldorf",
            "webpage": "https://www.uni-duesseldorf.de"
          }
        ],
        "contributor_name": "Jens",
        "contributor_surname": "Reiners",
        "orcid": ""
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2022-09-14",
    "storage_temperature": 10.0,
    "cell_temperature": 10.0,
    "exposure_time": 0.095,
    "number_of_frames": 40,
    "wavelength": 0.124,
    "sample_detector_distance": 3.0,
    "concentration_min": 0.7,
    "concentration_max": 10.6,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.321,
    "s_max": 4.089,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "5.0",
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": "Synchrotron SAXS data from solutions of crTPpart2 of CysK in 20 mM HEPES, 300 mM NaCl, pH 8 were collected on the EMBL P12 beam line at PETRA III (DESY; Hamburg, Germany) using a Pilatus 6M detector at a sample-detector distance of 3 m and at a wavelength of λ = 0.124 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). Solute concentrations ranging between 0.7 and 10.6 mg/ml were measured at 10°C. 40 successive 0.095 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted. The low angle data collected at lower concentrations were extrapolated to infinite dilution and merged with the higher concentration data to yield the final composite scattering curve.",
  "tags": [],
  "intensity_unit": "1/cm",
  "experimental_mw": 13.69,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": 17.7,
  "porod_mw_error": null,
  "pddf_i0": 0.008933,
  "pddf_i0_error": null,
  "guinier_i0": 0.00893092,
  "guinier_i0_error": null,
  "pddf_rg": 1.672,
  "pddf_rg_error": null,
  "guinier_rg": 1.65,
  "guinier_rg_error": 0.004,
  "pddf_dmax": 6.17,
  "pddf_dmax_error": null,
  "porod_volume": 28.34,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 1,
  "guinier_point_last": 168,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDWW3_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2025-10-13T13:58:55.484517+02:00",
  "bragg_peak": []
}

{
  "code": "SASDWW3",
  "status": "success",
  "started_at": "2026-08-11T14:09:47.887696+00:00",
  "finished_at": "2026-08-11T14:09:57.115760+00:00",
  "source_last_modified": "2025-10-13T13:58:55.484517+02:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDWW3/",
      "path": "/data/saxsdb/sasbdb/entries/w3/sasdww3/source/summary.json",
      "size": 6791,
      "sha256": "c879440a2567cb5656fa7e5742cbb734533526e78a3bf16c80081635ab0cb301"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDWW3.dat",
      "path": "/data/saxsdb/sasbdb/entries/w3/sasdww3/source/SASDWW3.dat",
      "size": 62214,
      "sha256": "ed1049f970e082a65ca9a8ce2e2cffb68ef22c464eb7740918c8828e562f90c9",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDWW3.out",
      "path": "/data/saxsdb/sasbdb/entries/w3/sasdww3/source/SASDWW3.out",
      "size": 113609,
      "sha256": "dc15cf21e1e4f3e5daf4353b4e4c17d5dbe5e18ea61ed24499a4fc1d40057e6e",
      "role": "pddf"
    },
    {
      "status": "not_available",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDWW3.sascif",
      "path": "/data/saxsdb/sasbdb/entries/w3/sasdww3/source/SASDWW3.sascif",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDWW3.zip",
      "path": "/data/saxsdb/sasbdb/entries/w3/sasdww3/source/SASDWW3.zip",
      "size": 43246,
      "sha256": "213083cae226870b9ae6553e09d4073dd8ec74313dc7db9760c5f5d95e8fa343",
      "role": "full_entry_zip",
      "zip_member_count": 2,
      "zip_validation": "central_directory_readable"
    }
  ]
}