chloroplast trigger factor from Chlamydomonas reinhardtii

{
  "code": "SASDX22",
  "status": "Published",
  "type_of_curve": "Merged",
  "angular_unit": "1/nm",
  "project": {
    "title": "Structural and molecular comparison of bacterial and eukaryotic trigger factors.",
    "publication": {
      "title": "Structural and molecular comparison of bacterial and eukaryotic trigger factors.",
      "author_list": "Ries F, Carius Y, Rohr M, Gries K, Keller S, Lancaster CRD, Willmund F",
      "journal": "Sci Rep",
      "doi": "10.1038/s41598-017-10625-2",
      "pmid": "28878399",
      "published_date": "2017 Sep 6"
    },
    "status": "released",
    "submitted_date": "2025-02-27",
    "released_date": "2025-03-07"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDX22.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDX22.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDX22_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDX22_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDX22_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDX22_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDX22.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": "Dectris",
        "name": "Pilatus 1M",
        "resolution": 172.0
      },
      "name": "ESRF",
      "city": "Grenoble",
      "country": "France",
      "beamline_name": "BM29",
      "beam_geometry": "",
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "peptidylprolyl isomerase",
          "short_name": "CrTIG1",
          "sequence": "AAAGKEKDVKVEVSVAVEELGTCSRSAIITVPASTVKDIFKRGVKRIERDVVG\r\nQLKGWQAGKPLPLSMVIQQVGGQNKFKTFCLEELLLEALPKGIESARNGRAVDPASVTVP\r\nPEDFPSMLERYDPAKEFFFRAMFDVAPPVVWRTPLEELEVTIRDTGDFSTDAAAADDLIR\r\nQYRKQHGFSRVVAGRGLQLGDTLVIDLEITSKATGQALPGLTHKRFSFDTEADVLGITSG\r\nMLGMKAGESRTFNMSMPEDYDVEFWQSMPVKVAAKVHEIFEWTLPEFNDEYVAKQHEGKW\r\nGSAKEMREALIASTAMQRVTELDKALEDAVVKAVADALDMPEVPPRMVEQLGERQFQAQL\r\nLQMIEDRIGSREDVEKLATEEMAAEFIRERKKDLEDQVKFNLAVDDIWVRKGLVLEDEAV\r\nEAEFSLRARQMEAVGQPFDREDMLDDVRETVKSVTVIEWLKDNVKRHVLPYTAADDKAAK\r\nAKGEPVAV",
          "organism": "Chlamydomonas reinhardtii",
          "uniprot_code": "A8JD56",
          "uniprot_range_first": 68,
          "uniprot_range_last": 548,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MMLTLKNQVLAARAGKRTACAPAGLPRSSGATQALVAAVGAPALAAPTATPCARRSVDVS\nRGALQVCAAAGKEKDVKVEVSVAVEELGTCSRSAIITVPASTVKDIFKRGVKRIERDVVG\nQLKGWQAGKPLPLSMVIQQVGGQNKFKTFCLEELLLEALPKGIESARNGRAVDPASVTVP\nPEDFPSMLERYDPAKEFFFRAMFDVAPPVVWRTPLEELEVTIRDTGDFSTDAAAADDLIR\nQYRKQHGFSRVVAGRGLQLGDTLVIDLEITSKATGQALPGLTHKRFSFDTEADVLGITSG\nMLGMKAGESRTFNMSMPEDYDVEFWQSMPVKVAAKVHEIFEWTLPEFNDEYVAKQHEGKW\nGSAKEMREALIASTAMQRVTELDKALEDAVVKAVADALDMPEVPPRMVEQLGERQFQAQL\nLQMIEDRIGSREDVEKLATEEMAAEFIRERKKDLEDQVKFNLAVDDIWVRKGLVLEDEAV\nEAEFSLRARQMEAVGQPFDREDMLDDVRETVKSVTVIEWLKDNVKRHVLPYTAADDKAAK\nAKGEPVAV",
          "mw": 53.731,
          "total_mw": 53.731,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": ""
        }
      ],
      "buffer": {
        "name": "20 mM Tris pH 7.5, 150 mM KCl",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": null,
        "deuteration": null
      },
      "purity_method": null,
      "name": "chloroplast trigger factor from Chlamydomonas reinhardtii",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": null,
            "full_name": "Saarland University",
            "webpage": null
          }
        ],
        "contributor_name": "Yvonne",
        "contributor_surname": "Carius",
        "orcid": "https://orcid.org/0000-0003-3902-3122"
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2017-04-30",
    "storage_temperature": 4.0,
    "cell_temperature": 20.0,
    "exposure_time": 1.0,
    "number_of_frames": 10,
    "wavelength": 0.09919,
    "sample_detector_distance": 2.867,
    "concentration_min": 0.5,
    "concentration_max": 8.0,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.035,
    "s_max": 4.944,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [
    {
      "models": [
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDX22_fit1_model1_img.png",
          "software": "DAMMIN",
          "pdb_link": [],
          "model_title": null,
          "type_of_model": "dummy",
          "software_version": null,
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDX22_fit1_model1.pdb",
          "model_mw": 79.25,
          "bead_radius": 3.75,
          "log": null,
          "symmetry": null,
          "comment": null,
          "user": 1190
        }
      ],
      "fit_unit": "1/A",
      "fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDX22_fit1_fixed_fit_img.png",
      "software": "DAMMIN",
      "chi_square_value": 0.792,
      "p_value": 0.0,
      "fit_residual_plot": "SASDX22_fit1_fitresiduals_img.png",
      "fit_data": "https://www.sasbdb.org/media/fitting_files/SASDX22_fit1.fir",
      "fit_log": null,
      "software_version": null,
      "description": ""
    }
  ],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "5.0",
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": "Synchrotron SAXS data from solutions of chloroplast trigger factor from Chlamydomonas reinhardtii in 20 mM Tris pH 7.5, 150 mM KCl were collected on the BM29 beam line at the ESRF (Grenoble, France) using a Pilatus 1M detector at a sample-detector distance of 2.9 m and at a wavelength of λ = 0.09919 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). Solute concentrations ranging between 0.5 and 8 mg/ml were measured at 20°C. 10 successive 1 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted. The low angle data collected at lower concentration were merged with the highest concentration high angle data to yield the final composite scattering curve.",
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 49.0,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": 61.0,
  "porod_mw_error": null,
  "pddf_i0": 50.96,
  "pddf_i0_error": null,
  "guinier_i0": 51.8001,
  "guinier_i0_error": null,
  "pddf_rg": 3.851,
  "pddf_rg_error": null,
  "guinier_rg": 3.85,
  "guinier_rg_error": 0.016,
  "pddf_dmax": 12.46,
  "pddf_dmax_error": null,
  "porod_volume": 103.37,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 32,
  "guinier_point_last": 63,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDX22_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2025-03-07T08:15:48.467610+01:00",
  "bragg_peak": []
}

{
  "code": "SASDX22",
  "status": "success",
  "started_at": "2026-08-11T13:29:15.974653+00:00",
  "finished_at": "2026-08-11T13:29:23.628668+00:00",
  "source_last_modified": "2025-03-07T08:15:48.467610+01:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDX22/",
      "path": "/data/saxsdb/sasbdb/entries/22/sasdx22/source/summary.json",
      "size": 8046,
      "sha256": "301686f39e956628571bef68dca999a46bafb4f61ce194b3e768d050bca99877"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDX22.dat",
      "path": "/data/saxsdb/sasbdb/entries/22/sasdx22/source/SASDX22.dat",
      "size": 48041,
      "sha256": "0ab6216ec343d667f90ad179d8cd505b94c85c167c9d891b135acf500581ad27",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDX22.out",
      "path": "/data/saxsdb/sasbdb/entries/22/sasdx22/source/SASDX22.out",
      "size": 58500,
      "sha256": "0c5bb863dc1a8a7075d286b2c635808c44f984b78f0fe7f69f82ceff8b4d74af",
      "role": "pddf"
    },
    {
      "status": "not_available",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDX22.sascif",
      "path": "/data/saxsdb/sasbdb/entries/22/sasdx22/source/SASDX22.sascif",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDX22.zip",
      "path": "/data/saxsdb/sasbdb/entries/22/sasdx22/source/SASDX22.zip",
      "size": 41505,
      "sha256": "3c82324c5aef96032e7e1b92ed3028a78a1e830c338fc7a1b8bc589b3c856b42",
      "role": "full_entry_zip",
      "zip_member_count": 4,
      "zip_validation": "central_directory_readable"
    }
  ]
}