The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDX37",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/nm",
"project": {
"title": "Structural and functional characterization of VapBC52 toxin-antitoxin system from Mycobacterium tuberculosis.",
"publication": {
"title": "Structural and functional characterization of VapBC52 toxin-antitoxin system from Mycobacterium tuberculosis.",
"author_list": "Singh M, Singh C, Nair AV, Ahmad I, Sharma A, Bhasin M, Jain V, Singh R, Thakur KG",
"journal": "Nucleic Acids Res",
"doi": "10.1093/nar/gkag611",
"pmid": "42306950",
"published_date": "2026 Jun 8"
},
"status": "released",
"submitted_date": "2025-07-28",
"released_date": "2026-06-18"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDX37.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDX37.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDX37_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDX37_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDX37_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDX37_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDX37.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus3 2M",
"resolution": 0.172
},
"name": "ESRF",
"city": "Grenoble",
"country": "France",
"beamline_name": "BM29",
"beam_geometry": "point",
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Ribonuclease VapC52",
"short_name": "VapC52",
"sequence": "GSSHHHHHHSQASLYSFDTSAILNGRRDLFRPAVFRSLWGRVEDAISAGQIRSVDEVQRELARRDDDAKRWADGQTGLFCPLDEQIQQAARHILRLHPNMVRQGGRRSAADPFVIALAMVNNATVVTQETASGNIEKPRIPDVCDALGVPWLTLMGYIEAQGWTF",
"organism": "Mycobacterium tuberculosis",
"uniprot_code": null,
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "dimer",
"molecular_type": "protein",
"uniprot_sequence": "",
"mw": 18.58,
"total_mw": 37.16,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": ""
},
{
"long_name": "Antitoxin VapB52",
"short_name": "VapB52",
"sequence": "VESSVLRWARESCGLTEVAAARKLGLPDDRVAAWEVGEVVPTIAQLRKAAEVYKRSLAVFFLSEPPEGFDTLRDFRRLDGAASGQWTPGLHEEFRRAHTQRDFALELADAEDREIPGAWRLPLSGDEADADIAARIRKALIEVSPLPIPVASVDPYEHLNAWVSAIETSGVLVLATRGGKVAIDEMRGMCLYFDELPVIVLNGSDHPRPRLFSLLHEFVHVVLHTEGLCDVIADAHPSTQDRSLEARCNAIAAAVLMPADVVRARPEVIVRSETPSSWDYESLRPVAAHFGVSAEAFLRRLSTLGIVPVEVYRQRRAEFIAAHEDEAERARSAGGGNWYRNTVRDLGKGYVRAVTDAHRRRVIDSNTAAIYLDAKVSQIPKLAESAELRSVV",
"organism": "Mycobacterium tuberculosis",
"uniprot_code": null,
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "",
"mw": 43.29,
"total_mw": 43.29,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": ""
}
],
"buffer": {
"name": "20 mM HEPES, 150 mM NaCl, 10% glycerol",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 8.0,
"deuteration": null
},
"purity_method": null,
"name": "Rv2514c-Rv2515c VapBC52 complex",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "CSIR",
"address": "Chandigarh, India",
"full_name": "CSIR-Institute of Microbial Technology",
"webpage": "http://www.imtech.res.in/"
}
],
"contributor_name": "Krishan",
"contributor_surname": "Gopal",
"orcid": null
},
{
"affiliation": [
{
"short_name": "CSIR",
"address": "Chandigarh, India",
"full_name": "CSIR-Institute of Microbial Technology",
"webpage": "http://www.imtech.res.in/"
}
],
"contributor_name": "Charandeep",
"contributor_surname": "Singh",
"orcid": "https://orcid.org/0009-0000-6148-6380"
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2023-05-05",
"storage_temperature": 4.0,
"cell_temperature": 20.0,
"exposure_time": 2.0,
"number_of_frames": 700,
"wavelength": 0.099,
"sample_detector_distance": 2.81,
"concentration_min": null,
"concentration_max": 1.0,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.063,
"s_max": 5.21,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDX37_fit1_model1_img.png",
"software": "GASBOR",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDX37_fit1_model1.cif",
"model_mw": null,
"bead_radius": null,
"log": "https://www.sasbdb.org/media/log_files/rv251425_12.log",
"symmetry": "P1",
"comment": null,
"user": 1231
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDX37_fit1_fixed_fit_img.png",
"software": "GASBOR",
"chi_square_value": 2.93,
"p_value": 0.0,
"fit_residual_plot": "SASDX37_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDX37_fit1.fir",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/rv251425_12.log",
"software_version": null,
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": null,
"experiment_description": null,
"tags": [],
"intensity_unit": "1/cm",
"experimental_mw": 80.45,
"experimental_mw_error": null,
"guinier_i0_mw": 82.56,
"guinier_i0_mw_error": null,
"porod_mw": 82.56,
"porod_mw_error": null,
"pddf_i0": 99.71,
"pddf_i0_error": null,
"guinier_i0": 99.4391,
"guinier_i0_error": null,
"pddf_rg": 3.134,
"pddf_rg_error": null,
"guinier_rg": 3.1,
"guinier_rg_error": 0.014,
"pddf_dmax": 10.5,
"pddf_dmax_error": null,
"porod_volume": 107.33,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 17,
"guinier_point_last": 43,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDX37_datloglog_img.png",
"symmetry": null,
"last_modified": "2026-06-18T16:45:32.452258+02:00",
"bragg_peak": []
}
