The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDXF6",
"status": "Published",
"type_of_curve": "SEC-SAS",
"angular_unit": "1/nm",
"project": {
"title": "Acylation of the RTX toxin MbxA stimulates host membrane disruption through a specific interaction with cholesterol",
"publication": {
"title": "Acylation of the RTX toxin MbxA stimulates host membrane disruption through a specific interaction with cholesterol",
"author_list": "Chacko F, Ganz S, Pfitzer-Bilsing A, Hänsch S, Westhoff P, Weidtkamp-Peters S, Smits S, Exterkate M, Schmitt L",
"journal": "Biochimica et Biophysica Acta (BBA) - Biomembranes",
"doi": "10.1016/j.bbamem.2025.184487",
"pmid": null,
"published_date": "2025 Nov"
},
"status": "released",
"submitted_date": "2025-04-02",
"released_date": "2026-03-02"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDXF6.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDXF6.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDXF6_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDXF6_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDXF6_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDXF6_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDXF6.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus 6M",
"resolution": null
},
"name": "PETRA III",
"city": "DESY; Hamburg",
"country": "Germany",
"beamline_name": "EMBL P12",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "RTX cytotoxin pro-MbxA without acylation",
"short_name": "pro-MbxA",
"sequence": "HHHHHHMSNINVIKSNIQAGLNSTKSGLKNLYLAIPKDYDPQKGGTLNDFIKAADELGIARLAEEPNHTETAKKSV\r\nDTVNQFLSLTQTGIAISATKLEKFLQKHSTNKLAKGLDSVENIDRKLGKASNVLSTLSSFLGTALAGIEL\r\nDSLIKKGDAAPDALAKASIDLINEIIGNLSQSTQTIEAFSSQLAKLGSTISQAKGFSNIGNKLQNLNFSK\r\nTNLGLEIITGLLSGISAGFALADKNASTGKKVAAGFELSNQVIGNVTKAISSYVLAQRVAAGLSTTGAVA\r\nALITSSIMLAISPLAFMNAADKFNHANALDEFAKQFRKFGYDGDHLLAEYQRGVGTIEASLTTISTALGA\r\nVSAGVSAAAVGSAVGAPIALLVAGVTGLISGILEASKQAMFESVANRLQGKILEWEKQNGGQNYFDKGYD\r\nSRYAAYLANNLKFLSELNKELEAERVIAITQQRWDNNIGELAGITKLGERIKSGKAYADAFEDGKKVEAG\r\nSNITLDAKTGIIDISNSNGKKTQALHFTSPLLTAGTESRERLTNGKYSYINKLKFGRVKNWQVTDGEASS\r\nKLDFSKVIQRVAETEGTDEIGLIVNAKAGNDDIFVGQGKMNIDGGDGHDRVFYSKDGGFGNITVDGTSAT\r\nEAGSYTVNRKVARGDIYHEVVKRQETKVGKRTETIQYRDYELRKVGYGYQSTDNLKSVEEVIGSQFNDVF\r\nKGSKFNDIFHSGEGDDLLDGGAGDDRLFGGKGNDRLSGDEGDDLLDGGSGDDVLNGGAGNDVYIFRKGDG\r\nNDTLYDGTGNDKLAFADANISDIMIERTKEGIIVKRNDHSGSINIPRWYITSNLQNYQSNKTDHKIEQLI\r\nGKDGSYITSDQIDKILQDKKDGTVITSQELKKLADENKSQKLSASDIASSLNKLVGSMALFGTANSVSSN\r\nALQPITQPTQGILAPSV",
"organism": "Moraxella bovis",
"uniprot_code": "Q93GI2",
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MSNINVIKSNIQAGLNSTKSGLKNLYLAIPKDYDPQKGGTLNDFIKAADELGIARLAEEP\nNHTETAKKSVDTVNQFLSLTQTGIAISATKLEKFLQKHSTNKLAKGLDSVENIDRKLGKA\nSNVLSTLSSFLGTALAGIELDSLIKKGDAAPDALAKASIDLINEIIGNLSQSTQTIEAFS\nSQLAKLGSTISQAKGFSNIGNKLQNLNFSKTNLGLEIITGLLSGISAGFALADKNASTGK\nKVAAGFELSNQVIGNVTKAISSYVLAQRVAAGLSTTGAVAALITSSIMLAISPLAFMNAA\nDKFNHANALDEFAKQFRKFGYDGDHLLAEYQRGVGTIEASLTTISTALGAVSAGVSAAAV\nGSAVGAPIALLVAGVTGLISGILEASKQAMFESVANRLQGKILEWEKQNGGQNYFDKGYD\nSRYAAYLANNLKFLSELNKELEAERVIAITQQRWDNNIGELAGITKLGERIKSGKAYADA\nFEDGKKVEAGSNITLDAKTGIIDISNSNGKKTQALHFTSPLLTAGTESRERLTNGKYSYI\nNKLKFGRVKNWQVTDGEASSKLDFSKVIQRVAETEGTDEIGLIVNAKAGNDDIFVGQGKM\nNIDGGDGHDRVFYSKDGGFGNITVDGTSATEAGSYTVNRKVARGDIYHEVVKRQETKVGK\nRTETIQYRDYELRKVGYGYQSTDNLKSVEEVIGSQFNDVFKGSKFNDIFHSGEGDDLLDG\nGAGDDRLFGGKGNDRLSGDEGDDLLDGGSGDDVLNGGAGNDVYIFRKGDGNDTLYDGTGN\nDKLAFADANISDIMIERTKEGIIVKRNDHSGSINIPRWYITSNLQNYQSNKTDHKIEQLI\nGKDGSYITSDQIDKILQDKKDGTVITSQELKKLADENKSQKLSASDIASSLNKLVGSMAL\nFGTANSVSSNALQPITQPTQGILAPSV",
"mw": 99.667,
"total_mw": 99.667,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": "non-acylated form, pro-MbxA"
}
],
"buffer": {
"name": "50 mM Tris, 100 mM NaCl, 10mM CaCl2",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.8,
"deuteration": null
},
"purity_method": null,
"name": "RTX cytotoxin pro-MbxA without acylation (pro-MbxA)",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "Düsseldorf, Germany",
"full_name": "Heinrich Heine University Düsseldorf",
"webpage": "https://www.uni-duesseldorf.de"
}
],
"contributor_name": "Jens",
"contributor_surname": "Reiners",
"orcid": ""
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2022-05-09",
"storage_temperature": 10.0,
"cell_temperature": 20.0,
"exposure_time": 0.995,
"number_of_frames": 3000,
"wavelength": 0.155,
"sample_detector_distance": 3.0,
"concentration_min": null,
"concentration_max": 5.3,
"sample_volume": 100.0,
"flow_rate": 0.5,
"s_min": 0.073,
"s_max": 5.723,
"total_exposure_time": null,
"seccolumn": 5
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDXF6_fit1_model1_img.png",
"software": "SREFLEX",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": "ATSAS 3.0.5 (r13837)",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDXF6_fit1_model1.pdb",
"model_mw": 99.64,
"bead_radius": null,
"log": "https://www.sasbdb.org/media/log_files/report_3lr1YNR.txt",
"symmetry": "P1",
"comment": null,
"user": 402
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDXF6_fit1_fixed_fit_img.png",
"software": "SREFLEX",
"chi_square_value": 1.178,
"p_value": 0.0,
"fit_residual_plot": "SASDXF6_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDXF6_fit1.fit",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/log_pUmvNmS.txt",
"software_version": "ATSAS 3.0.5 (r13837)",
"description": ""
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDXF6_fit2_model1_img.png",
"software": "GASBOR",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "ATSAS 3.0.5 (r13837)",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDXF6_fit2_model1.pdb",
"model_mw": null,
"bead_radius": null,
"log": "https://www.sasbdb.org/media/log_files/mbxP1g8.log",
"symmetry": "P1",
"comment": null,
"user": 402
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDXF6_fit2_fixed_fit_img.png",
"software": "GASBOR",
"chi_square_value": 1.19,
"p_value": 0.0,
"fit_residual_plot": "SASDXF6_fit2_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDXF6_fit2.fir",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/mbxP1g8.log",
"software_version": "ATSAS 3.0.5 (r13837)",
"description": ""
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDXF6_fit3_model1_img.png",
"software": "AlphaFold",
"pdb_link": [],
"model_title": "SASDXF6_alfafold_fit",
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDXF6_fit3_model1.pdb",
"model_mw": 99.64,
"bead_radius": 1.9,
"log": null,
"symmetry": null,
"comment": null,
"user": 402
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDXF6_fit3_fixed_fit_img.png",
"software": "CRYSOL",
"chi_square_value": 13.232,
"p_value": 0.0,
"fit_residual_plot": "SASDXF6_fit3_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDXF6_fit3.fit",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/SASDXF3_fit1_model1.log",
"software_version": null,
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": null,
"experiment_description": null,
"tags": [],
"intensity_unit": "1/cm",
"experimental_mw": 104.85,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 95.98,
"porod_mw_error": null,
"pddf_i0": 0.0494,
"pddf_i0_error": null,
"guinier_i0": 0.049073,
"guinier_i0_error": null,
"pddf_rg": 3.903,
"pddf_rg_error": null,
"guinier_rg": 3.803,
"guinier_rg_error": 0.01,
"pddf_dmax": 13.36,
"pddf_dmax_error": null,
"porod_volume": 153.56,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 41,
"guinier_point_last": 123,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDXF6_datloglog_img.png",
"symmetry": null,
"last_modified": "2026-03-02T17:17:55.978050+01:00",
"bragg_peak": []
}
