The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDXH8",
"status": "Published",
"type_of_curve": "SEC-SAS",
"angular_unit": "1/A",
"project": {
"title": "Bacterial targeting of the neutrophil inhibitory receptor LILRB3 to evade antibody immunity.",
"publication": {
"title": "Bacterial targeting of the neutrophil inhibitory receptor LILRB3 to evade antibody immunity.",
"author_list": "Rumpret M, Lewis Marffy AL, Zhang Y, van Woudenbergh E, van der Lans SPA, Xu X, Fu Z, Zhao Y, Catton EA, Paré G, McGregor F, Spiller OB, Fernandes MJ, de Haas CJC, van Strijp JAG, van Sorge NM, Geisbrecht BV, McCarthy AJ",
"journal": "Nat Commun",
"doi": "10.1038/s41467-026-74098-6",
"pmid": "42277001",
"published_date": "2026 Jun 11"
},
"status": "released",
"submitted_date": "2024-07-11",
"released_date": "2026-06-16"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDXH8.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDXH8.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDXH8_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDXH8_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDXH8_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDXH8_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDXH8.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus3 X 2M",
"resolution": 172.0
},
"name": "Advanced Light Source (ALS)",
"city": "Berkeley, CA",
"country": "USA",
"beamline_name": "12.3.1 (SIBYLS)",
"beam_geometry": "",
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Leukocyte immunoglobulin-like receptor subfamily B member 3 (P288R)",
"short_name": "LILRB3",
"sequence": "GPFPKPTLWAEPGSVISWGSPVTIWCQGSLEAQEYRLDKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLELVMTGFYNKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQALFPVGPVNPSHRWRFTCYYYYMNTPQVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYDRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSRSHGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSFPSEPLELMVSGHSGGSSLPPTGPPSTPGLGRYLEHHHHHH",
"organism": "Homo sapiens",
"uniprot_code": "A0A0G2JM46",
"uniprot_range_first": 24,
"uniprot_range_last": 443,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MTPALTALLCLGLSLGPRTRVQAGPFPKPTLWAEPGSVISWGSPVTIWCQGSLEAQEYRL\nDKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLELVMTGF\nYNKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQAL\nFPVGPVNPSHRWRFTCYYYYMNTPQVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQS\nLTLQCGSDVGYDRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSHGGQYRCYGAH\nNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEG\nAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSFPSEPLELMVSG\nHSGGSSLPPTGPPSTPGLGRYLEVLIGVSVAFVLLLFLLLFLLLRRQRHSKHRTSDQRKT\nDFQRPAGAAETEPKDRGLLRRSSPAADVQEENLYAAVKDTQSEDRVELDSQQSPHDEDPQ\nAVTYAPVKHSSPRREMASPPSSLSGEFLDTKDRQVEEDRQMDTEAAASEASQDVTYAQLH\nSLTLRRKATEPPPSQEGEPPAEPSIYATLAIH",
"mw": 46.951,
"total_mw": 46.951,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": "The protein construct used for SAXS contains an additional non-native polyhistidine tag at the C-terminus (HHHHHH)."
}
],
"buffer": {
"name": "20mM HEPES, 140mM NaCl",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.4,
"deuteration": null
},
"purity_method": null,
"name": "Leukocyte Immunoglobulin-Like Receptor LILR-B3",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": null,
"full_name": "Kansas State University",
"webpage": null
}
],
"contributor_name": "Ying",
"contributor_surname": "Zhang",
"orcid": "https://orcid.org/0009-0003-1603-7561"
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2023-10-05",
"storage_temperature": null,
"cell_temperature": null,
"exposure_time": null,
"number_of_frames": null,
"wavelength": null,
"sample_detector_distance": null,
"concentration_min": null,
"concentration_max": null,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.109,
"s_max": 4.729,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDXH8_fit1_model1_img.png",
"software": "MODELLER",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDXH8_fit1_model1.pdb",
"model_mw": 46.95,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": null,
"user": 1086
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDXH8_fit1_fixed_fit_img.png",
"software": "FoXS",
"chi_square_value": 1.015849,
"p_value": 0.0,
"fit_residual_plot": "SASDXH8_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDXH8_fit1.fit",
"fit_log": null,
"software_version": null,
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": "Synchrotron small-angle X-ray scattering (SAXS) data on Leukocyte Immunoglobulin-Like Receptor (LILR-B3) were collected at SIBYLS beamline 12.3.1 of the Advanced Light Source in SEC-SAXS mode. In-line size-exclusion chromatography (SEC) was performed using an Agilent 1260 HPLC system. The SEC conditions were as follows: a 60 µL sample at 5 mg/mL was injected onto a Shodex KW-803 column at 4 °C that had been previously equilibrated in 20 mM HEPES, 140 mM NaCl, pH 7.4, and eluted at 0.65 mL/min. Scattering was recorded on a Pilatus3 X 2M detector at a sample-to-detector distance of 2.1 m and a wavelength of λ = 0.1127 nm (I(q) vs q; q = 4π sin θ/λ, where 2θ is the scattering angle). 913 successive 2-s frames were collected. The scattering curves were normalized to the transmitted-beam intensity, radially averaged, and corrected by subtracting the solvent blank.",
"experiment_description": "-",
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 57.8,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 85.0,
"porod_mw_error": null,
"pddf_i0": 28.37,
"pddf_i0_error": 0.27,
"guinier_i0": 27.5635,
"guinier_i0_error": null,
"pddf_rg": 3.81,
"pddf_rg_error": 0.42,
"guinier_rg": 3.6,
"guinier_rg_error": 0.481,
"pddf_dmax": 13.5,
"pddf_dmax_error": null,
"porod_volume": 137.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 1,
"guinier_point_last": 50,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDXH8_datloglog_img.png",
"symmetry": null,
"last_modified": "2026-06-16T09:24:11.486470+02:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDXH8",
"status": "success",
"started_at": "2026-08-11T16:27:50.392499+00:00",
"finished_at": "2026-08-11T16:27:58.433370+00:00",
"source_last_modified": "2026-06-16T09:24:11.486470+02:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDXH8/",
"path": "/data/saxsdb/sasbdb/entries/h8/sasdxh8/source/summary.json",
"size": 8466,
"sha256": "52a481cb808d19ce9c8126ee8114e0856008d4ab943b159cbddddeb3d1a9fbeb"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDXH8.dat",
"path": "/data/saxsdb/sasbdb/entries/h8/sasdxh8/source/SASDXH8.dat",
"size": 53120,
"sha256": "8dade7ef0aa09ea896dee217103c202ac78a8c2c0de4d33384dff7aa494320e2",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDXH8.out",
"path": "/data/saxsdb/sasbdb/entries/h8/sasdxh8/source/SASDXH8.out",
"size": 82287,
"sha256": "fedaf872e7a5ec69f8d395c74883073fb8c4d520fb31ad06386ef79c3afd2c6d",
"role": "pddf"
},
{
"status": "not_available",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDXH8.sascif",
"path": "/data/saxsdb/sasbdb/entries/h8/sasdxh8/source/SASDXH8.sascif",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDXH8.zip",
"path": "/data/saxsdb/sasbdb/entries/h8/sasdxh8/source/SASDXH8.zip",
"size": 116339,
"sha256": "597213f49294fd4dc2adadf8b6e3d585c7d582465b787c2d3d824fd0f0959681",
"role": "full_entry_zip",
"zip_member_count": 4,
"zip_validation": "central_directory_readable"
}
]
}
