The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDXJ3",
"status": "Published",
"type_of_curve": "Merged",
"angular_unit": "1/nm",
"project": {
"title": "Structural flexibility of the human vault particle revealed by high-resolution cryo-EM and molecular dynamics simulations.",
"publication": {
"title": "Structural flexibility of the human vault particle revealed by high-resolution cryo-EM and molecular dynamics simulations.",
"author_list": "Lapenta F, Palacio-Rodriguez K, Cruz-León S, Marrancone S, Aupič J, Marechal N, Durand A, Moussaoui D, Covaceuszach S, Gangupam B, D'Ercole C, Parra C, Cotugno D, Tomaino G, Tortora P, de Marco A, Cassetta A, Magistrato A, Hummer G",
"journal": "Nat Commun",
"doi": "10.1038/s41467-026-72674-4",
"pmid": "42069735",
"published_date": "2026 May 2"
},
"status": "released",
"submitted_date": "2025-04-11",
"released_date": "2026-04-27"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDXJ3.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDXJ3.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDXJ3_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDXJ3_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDXJ3_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDXJ3_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDXJ3.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus3 2M",
"resolution": 0.172
},
"name": "ESRF",
"city": "Grenoble",
"country": "France",
"beamline_name": "BM29",
"beam_geometry": "point",
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Major vault protein",
"short_name": "MVP",
"sequence": "MATEEFIIRIPPYHYIHVLDQNSNVSRVEVGPKTYIRQDNERVLFAPMRMVTVPPRHYCTVANPVSRDAQGLVLFDVTGQVRLRHADLEIRLAQDPFPLYPGEVLEKDITPLQVVLPNTALHLKALLDFEDKDGDKVVAGDEWLFEGPGTYIPRKEVEVVEIIQATIIRQNQALRLRARKECWDRDGKERVTGEEWLVTTVGAYLPAVFEEVLDLVDAVILTEKTALHLRARRNFRDFRGVSRRTGEEWLVTVQDTEAHVPDVHEEVLGVVPITTLGPHNYCVILDPVGPDGKNQLGQKRVVKGEKSFFLQPGEQLEQGIQDVYVLSEQQGLLLRALQPLEEGEDEEKVSHQAGDHWLIRGPLEYVPSAKVEVVEERQAIPLDENEGIYVQDVKTGKVRAVIGSTYMLTQDEVLWEKELPPGVEELLNKGQDPLADRGEKDTAKSLQPLAPRNKTRVVSYRVPHNAAVQVYDYREKRARVVFGPELVSLGPEEQFTVLSLSAGRPKRPHARRALCLLLGPDFFTDVITIETADHARLQLQLAYNWHFEVNDRKDPQETAKLFSVPDFVGDACKAIASRVRGAVASVTFDDFHKNSARIIRTAVFGFETSEAKGPDGMALPRPRDQAVFPQNGLVVSSVDVQSVEPVDQRTRDALQRSVQLAIEITTNSQEAAAKHEAQRLEQEARGRLERQKILDQSEAEKARKELLELEALSMAVESTGTAKAEAESRAEAARIEGEGSVLQAKLKAQALAIETEAELQRVQKVRELELVYARAQLELEVSKAQQLAEVEVKKFKQMTEAIGPSTIRDLAVAGPEMQVKLLQSLGLKSTLITDGSTPINLFNTAFGLLGMGPEGQPLGRRVASGPSPGEGISPQSAQAPQAPGDNHVVPVLR",
"organism": "Homo sapiens",
"uniprot_code": "Q14764",
"uniprot_range_first": 1,
"uniprot_range_last": 893,
"oligomerization": "other",
"molecular_type": "protein",
"uniprot_sequence": "MATEEFIIRIPPYHYIHVLDQNSNVSRVEVGPKTYIRQDNERVLFAPMRMVTVPPRHYCT\nVANPVSRDAQGLVLFDVTGQVRLRHADLEIRLAQDPFPLYPGEVLEKDITPLQVVLPNTA\nLHLKALLDFEDKDGDKVVAGDEWLFEGPGTYIPRKEVEVVEIIQATIIRQNQALRLRARK\nECWDRDGKERVTGEEWLVTTVGAYLPAVFEEVLDLVDAVILTEKTALHLRARRNFRDFRG\nVSRRTGEEWLVTVQDTEAHVPDVHEEVLGVVPITTLGPHNYCVILDPVGPDGKNQLGQKR\nVVKGEKSFFLQPGEQLEQGIQDVYVLSEQQGLLLRALQPLEEGEDEEKVSHQAGDHWLIR\nGPLEYVPSAKVEVVEERQAIPLDENEGIYVQDVKTGKVRAVIGSTYMLTQDEVLWEKELP\nPGVEELLNKGQDPLADRGEKDTAKSLQPLAPRNKTRVVSYRVPHNAAVQVYDYREKRARV\nVFGPELVSLGPEEQFTVLSLSAGRPKRPHARRALCLLLGPDFFTDVITIETADHARLQLQ\nLAYNWHFEVNDRKDPQETAKLFSVPDFVGDACKAIASRVRGAVASVTFDDFHKNSARIIR\nTAVFGFETSEAKGPDGMALPRPRDQAVFPQNGLVVSSVDVQSVEPVDQRTRDALQRSVQL\nAIEITTNSQEAAAKHEAQRLEQEARGRLERQKILDQSEAEKARKELLELEALSMAVESTG\nTAKAEAESRAEAARIEGEGSVLQAKLKAQALAIETEAELQRVQKVRELELVYARAQLELE\nVSKAQQLAEVEVKKFKQMTEAIGPSTIRDLAVAGPEMQVKLLQSLGLKSTLITDGSTPIN\nLFNTAFGLLGMGPEGQPLGRRVASGPSPGEGISPQSAQAPQAPGDNHVVPVLR",
"mw": 99.326,
"total_mw": 7747.0,
"number_molecules": 78,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": ""
}
],
"buffer": {
"name": "25 mM HEPES, 150 mM NaCl, 1 mM TCEP",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.5,
"deuteration": null
},
"purity_method": null,
"name": "Human major vault protein",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": null,
"full_name": "National Research Council",
"webpage": null
}
],
"contributor_name": "Jana",
"contributor_surname": "Aupič",
"orcid": ""
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2022-06-08",
"storage_temperature": 4.0,
"cell_temperature": 20.0,
"exposure_time": 1.0,
"number_of_frames": 10,
"wavelength": 0.0992,
"sample_detector_distance": 2.867,
"concentration_min": 0.5,
"concentration_max": 1.0,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.043,
"s_max": 5.22,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/primmednoH_img.png",
"software": "Other [static image]",
"pdb_link": [],
"model_title": null,
"type_of_model": "other",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDXJ3_fit1_model1.png",
"model_mw": null,
"bead_radius": 1.9,
"log": null,
"symmetry": null,
"comment": null,
"user": 201
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDXJ3_fit1_fixed_fit_img.png",
"software": "Pepsi-SAXS",
"chi_square_value": 5.0142,
"p_value": 0.0002,
"fit_residual_plot": "SASDXJ3_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDXJ3_fit1.fit",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/primmed-grenoble22crp.log",
"software_version": "3.0",
"description": ""
},
{
"models": [
{
"model_plot": null,
"software": "Other [static image]",
"pdb_link": [],
"model_title": null,
"type_of_model": "other",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDXJ3_fit2_model1.png",
"model_mw": null,
"bead_radius": 1.9,
"log": null,
"symmetry": null,
"comment": null,
"user": 201
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDXJ3_fit2_fixed_fit_img.png",
"software": "Pepsi-SAXS",
"chi_square_value": 8.4509,
"p_value": 0.0007,
"fit_residual_plot": "SASDXJ3_fit2_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDXJ3_fit2.fit",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/half-grenoble22crp.log",
"software_version": "3.0",
"description": ""
},
{
"models": [
{
"model_plot": null,
"software": "Other [static image]",
"pdb_link": [],
"model_title": null,
"type_of_model": "other",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDXJ3_fit3_model1.png",
"model_mw": null,
"bead_radius": 1.9,
"log": null,
"symmetry": null,
"comment": null,
"user": 201
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDXJ3_fit3_fixed_fit_img.png",
"software": "OLIGOMER",
"chi_square_value": 3.39,
"p_value": 0.0005,
"fit_residual_plot": "SASDXJ3_fit3_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDXJ3_fit3.fit",
"fit_log": null,
"software_version": "7.1",
"description": "The best fit was found for the following composition: 56 % 78-mer MVP, 44 % 39-mer MVP."
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": "All samples were centrifuged at 20,000 × g for 10 min at 4°C prior analysis. Guinier analysis cannot be reliable performed due to the size of the particle. The atomic coordinate files of the models displayed in this entry are made available in the 'Additional files' folder of the full entry zip archive.",
"experiment_description": "Synchrotron SAXS data from solutions of human major vault protein in 25 mM HEPES, 150 mM NaCl, 1 mM TCEP, pH 7.5 were collected on the BM29 beam line at the ESRF (Grenoble, France) using a Pilatus3 2M detector at a sample-detector distance of 2.9 m and at a wavelength of λ = 0.0992 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). Two samples at a concentration of 0.5 mg/mL were measured at 20°C. For each sample measurement, ten X-ray scattering measurements with 1-second exposure times were collected. The data were normalized to the intensity of the transmitted beam and radially averaged. Ten analogous sample frames were averaged, and buffer scattering was subtracted from the sample data.",
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 7660.0,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": null,
"porod_mw_error": null,
"pddf_i0": 483.1,
"pddf_i0_error": null,
"guinier_i0": 395.298,
"guinier_i0_error": null,
"pddf_rg": 22.43,
"pddf_rg_error": null,
"guinier_rg": 16.329,
"guinier_rg_error": 3.079,
"pddf_dmax": 65.0,
"pddf_dmax_error": 2.0,
"porod_volume": 16650.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 1,
"guinier_point_last": 4,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDXJ3_datloglog_img.png",
"symmetry": null,
"last_modified": "2026-05-11T16:51:37.897689+02:00",
"bragg_peak": []
}
