The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDXJ4",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/nm",
"project": {
"title": "Allergen-induced structural rearrangements in IgE: insights from SAXS and molecular dynamics.",
"publication": {
"title": "Allergen-induced structural rearrangements in IgE: insights from SAXS and molecular dynamics.",
"author_list": "Gómez-Velasco H, García-Ramírez B, Siliqi D, Graewert MA, Quintero-Martinez A, Ortega E, Rodríguez-Romero A",
"journal": "Int J Biol Macromol",
"doi": "10.1016/j.ijbiomac.2025.147658",
"pmid": "40953619",
"published_date": "2025 Sep 13"
},
"status": "released",
"submitted_date": "2025-05-07",
"released_date": "2025-09-17"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDXJ4.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDXJ4.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDXJ4_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDXJ4_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDXJ4_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDXJ4_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDXJ4.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus 6M",
"resolution": null
},
"name": "PETRA III",
"city": "DESY; Hamburg",
"country": "Germany",
"beamline_name": "EMBL P12",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Profilin-2",
"short_name": "PRF",
"sequence": "MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSDDDDKMSWQAYVDDHLMCEIEGNHLSAAAIIGQDGSVWAQSANFPQFKSEEITGIMSDFHEPGTLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMIVERLGDYLIDQGY",
"organism": "Hevea brasiliensis",
"uniprot_code": "Q9STB6",
"uniprot_range_first": 1,
"uniprot_range_last": 131,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MSWQAYVDDHLMCEIEGNHLSAAAIIGQDGSVWAQSANFPQFKSEEITGIMSDFHEPGTL\nAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMIVE\nRLGDYLIDQGY",
"mw": 18.283,
"total_mw": 18.283,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": "Allergen Hev b 8 protein (profilin). The protein construct contains an additional 39 non-native amino acids at the N-terminus (MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSDDDDK)."
}
],
"buffer": {
"name": "20 mM Tris, 50 mM NaCl",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 8.4,
"deuteration": null
},
"purity_method": null,
"name": "Allergen Hev b 8 protein, Profilin-2",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "Bari, Italy",
"full_name": "CNR - Institute of Crystallography, Bari, Italy",
"webpage": "http://www.ba.ic.cnr.it"
}
],
"contributor_name": "Dritan",
"contributor_surname": "Siliqi",
"orcid": "https://orcid.org/0000-0003-1415-8725"
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2025-04-11",
"storage_temperature": 4.0,
"cell_temperature": 20.0,
"exposure_time": 0.1,
"number_of_frames": 20,
"wavelength": 0.124,
"sample_detector_distance": 3.0,
"concentration_min": null,
"concentration_max": 5.8,
"sample_volume": 50.0,
"flow_rate": 0.6,
"s_min": 0.025,
"s_max": 7.266,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDXJ4_fit1_model1_img.png",
"software": "GASBOR",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDXJ4_fit1_model1.cif",
"model_mw": null,
"bead_radius": null,
"log": "https://www.sasbdb.org/media/log_files/GASBORon_2918.log",
"symmetry": null,
"comment": null,
"user": 396
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDXJ4_fit1_fixed_fit_img.png",
"software": "GASBOR",
"chi_square_value": 1.68,
"p_value": 0.0,
"fit_residual_plot": "SASDXJ4_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDXJ4_fit1.fir",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/GASBORon_2918.log",
"software_version": "3.2.1",
"description": ""
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDXJ4_fit2_model1_img.png",
"software": "PDB (Protein Data Bank)",
"pdb_link": [
{
"pdb_code": "7sdb",
"ext_code": "7SDB",
"ext_type": "pdb",
"difference_with_model": "identical"
}
],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDXJ4_fit2_model1.pdb",
"model_mw": 14.15,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": "profilin without histag is 14.1 kDa",
"user": 396
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDXJ4_fit2_fixed_fit_img.png",
"software": "CRYSOL",
"chi_square_value": 3.497,
"p_value": 0.0,
"fit_residual_plot": "SASDXJ4_fit2_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDXJ4_fit2.fit",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/7sbd_chainC_profilin.log",
"software_version": "4.0",
"description": "The MX model of profilin from chain C pdbID 7SBD"
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": null,
"i0_calibration_standard": null,
"description": "Synchrotron SAXS data from solutions of allergen Hev b 8 protein, Profilin-2 in 20 mM Tris, 50 mM NaCl, pH 8.4 were collected on the P12 beamline at DESY (Hamburg, Germany) using a Pilatus 6m detector at a sample-detector distance of 3.0 m and a wavelength of λ = 0.124 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). A solute concentration of 0.6 mg/ml was measured at 20°C. 20 successive 0.51 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged and brought into the absolute scale with respect to the intensity of the empty capillary and the water; the scattering of the solvent-blank was subtracted.",
"experiment_description": "A low-resolution dummy residue model was generated by using GASBOR. In this SAXS model the crystallographic model (PDB entry 7SBD, chain C), confirms the good quality of sample preparation before running the experiments for its complex with IgE antibody.",
"tags": [],
"intensity_unit": "1/cm",
"experimental_mw": 12.0,
"experimental_mw_error": null,
"guinier_i0_mw": 12.0,
"guinier_i0_mw_error": null,
"porod_mw": 13.0,
"porod_mw_error": null,
"pddf_i0": 0.06408,
"pddf_i0_error": null,
"guinier_i0": 0.0674299,
"guinier_i0_error": null,
"pddf_rg": 1.541,
"pddf_rg_error": null,
"guinier_rg": 1.695,
"guinier_rg_error": 0.007,
"pddf_dmax": 4.54,
"pddf_dmax_error": null,
"porod_volume": 21.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 87,
"guinier_point_last": 262,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDXJ4_datloglog_img.png",
"symmetry": null,
"last_modified": "2025-09-17T10:13:11.711922+02:00",
"bragg_peak": []
}
