The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDXQ9",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/A",
"project": {
"title": "Structure-based functionality of a multi-domain periplasmic chitodextrinase from marine bacterium Vibrio cholerae.",
"publication": {
"title": "Structure-based functionality of a multi-domain periplasmic chitodextrinase from marine bacterium Vibrio cholerae.",
"author_list": "Khumnonkhro K, Chongrungreang T, Sakuda S, Robinson RC, Fukamizo T, Suginta W",
"journal": "J Biol Chem",
"doi": "10.1016/j.jbc.2026.113351",
"pmid": "42480705",
"published_date": "2026 Jul 21"
},
"status": "released",
"submitted_date": "2025-09-30",
"released_date": "2025-10-16"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDXQ9.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDXQ9_2aWXeaY.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDXQ9_2aWXeaY_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDXQ9_2aWXeaY_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDXQ9_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDXQ9_2aWXeaY_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDXQ9.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Eiger X 1M & 9M",
"resolution": 0.001
},
"name": "NSRRC",
"city": "Hsinchu",
"country": "Taiwan",
"beamline_name": "TPS13A",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Chitodextrinase",
"short_name": "ChDex",
"sequence": "AVDCSTLPEWQSSAVYTGGAKVQHKGNAYQANYWTQNNDPETFSGNYAQWKLLDSCSTSGGTNQAPSVTLTAPLATAQVKAGEVMTLAANASDADGSVARVEFSVDGVLVGQATKAPYSASWTATKGTHEFSAVAFDDKG\r\nAVSTKNAVTLTVSDAGPANQAPTVAVALSASSVDVGTVVTLSAEAADADGSVEKVDFYVGGALVGTSAKA\r\nPYTLNYTATKAGSLAVYARATDNLGAATDSALTTLVVNGVAPVANCRPDGLYQTEGVQVPYCTVYDADGR\r\nEKMGVDHPRRVIGYFTSWRSGDDPQAAYLVKDIPWEQLTHINYAFVSIGSDGKVNVGDVNDPNNAAVGKE\r\nWPGVEIDPTLGFKGHFGALATYKQKYGVKTLISIGGWAETGGHFDANGNRVADGGFYTMTTNADGSINHA\r\nAIEKFAASAVEMIRKYKFDGVDIDYEYPTSMAGAGNPDDKGFMEPRRAYLWASYQELMRVLREKLDQASA\r\nQDGHHYMLTIAAPSSGYLLRGMETFDVTKYLDYVNIMSYDLHGAWNDHVGHNAALYDTGKDSELAQWNVY\r\nGTAQYGGIGYLNTDWAYHYFRGSMPAGRINIGVPYYTRGWQGVTGGENGLWGRAALPNQNLCAPGTGEGE\r\nKNNCGHGATGIDNMWHDVNAAGDEMGAGSNPMWHAKNLEKGIWGSYAAAYKLDPTTTPLIGTYVRNYDSV\r\nAVAPWLWNAEKKVFLSTEDKQSIDVKADYVIDKEVGGIMFWELAGDYSCYNLDANGKRTSVDPSEQACAT\r\nGKGEYHMGNTMTKAIYDKFKVATPYGNKVATGAIPAEAVNIAVKVGGFKVGDQNYPINPKITFTNNTGID\r\nIPGGTEFQFDIPVSAPDNAKDQSGGGLKVIASGHTRANNIGGLDGTMHRVAFSLPAWKSLPAGATYELDM\r\nVYYLPISGPANYTVKINNVEYAFSFEQPDLPVADLTAGGNTGGNTGGNTGGGTGGGSTGDVIQWVPGSTQ\r\nVQNGTTVTYNGKCFVAQNNPGVWESPTQSNWFWKEVTCPQA",
"organism": "Vibrio cholerae",
"uniprot_code": "Q9KLP3",
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MRVLEGKAGKSVFTLSTLTASCLMAFSSYAAVDCSTLPEWQSSAVYTGGAKVQHKGNAYQ\nANYWTQNNDPETFSGNYAQWKLLDSCSTSGGTNQAPSVTLTAPLATAQVKAGEVMTLAAN\nASDADGSVARVEFSVDGVLVGQATKAPYSASWTATKGTHEFSAVAFDDKGAVSTKNAVTL\nTVSDAGPANQAPTVAVALSASSVDVGTVVTLSAEAADADGSVEKVDFYVGGALVGTSAKA\nPYTLNYTATKAGSLAVYARATDNLGAATDSALTTLVVNGVAPVANCRPDGLYQTEGVQVP\nYCTVYDADGREKMGVDHPRRVIGYFTSWRSGDDPQAAYLVKDIPWEQLTHINYAFVSIGS\nDGKVNVGDVNDPNNAAVGKEWPGVEIDPTLGFKGHFGALATYKQKYGVKTLISIGGWAET\nGGHFDANGNRVADGGFYTMTTNADGSINHAAIEKFAASAVEMIRKYKFDGVDIDYEYPTS\nMAGAGNPDDKGFMEPRRAYLWASYQELMRVLREKLDQASAQDGHHYMLTIAAPSSGYLLR\nGMETFDVTKYLDYVNIMSYDLHGAWNDHVGHNAALYDTGKDSELAQWNVYGTAQYGGIGY\nLNTDWAYHYFRGSMPAGRINIGVPYYTRGWQGVTGGENGLWGRAALPNQNLCAPGTGEGE\nKNNCGHGATGIDNMWHDVNAAGDEMGAGSNPMWHAKNLEKGIWGSYAAAYKLDPTTTPLI\nGTYVRNYDSVAVAPWLWNAEKKVFLSTEDKQSIDVKADYVIDKEIGGIMFWELAGDYSCY\nNLDANGKRTSVDPSEQACATGKGEYHMGNTMTKAIYDKFKVATPYGNKVATGAIPAEAVN\nIAVKVGGFKVGDQNYPINPKITFTNNTGIDIPGGTEFQFDIPVSAPDNAKDQSGGGLKVI\nASGHTRANNIGGLDGTMHRVAFSLPAWKSLPAGATYELDMVYYLPISGPANYTVKINNVE\nYAFSFEQPDLPVADLTAGGNTGGNTGGNTGGGTGGGSTGDVIQWVPGSTQVQNGTTVTYN\nGKCFVAQNNPGVWESPTQSNWFWKEVTCPQA",
"mw": 108.548,
"total_mw": 108.548,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": ""
}
],
"buffer": {
"name": "100mM HEPES, 150mM NaCl",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.5,
"deuteration": null
},
"purity_method": null,
"name": "Native state of monomeric full-length glycoside hydrolase family18 chitodextrinase from Vibrio cholerae",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": null,
"full_name": "Vidyasirimedhi Institute of Science and Technology (VISTEC), Thailand",
"webpage": null
}
],
"contributor_name": "Kanokbhorn",
"contributor_surname": "Khumnonkhro",
"orcid": ""
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2025-04-09",
"storage_temperature": 25.0,
"cell_temperature": 10.0,
"exposure_time": 2.0,
"number_of_frames": 240,
"wavelength": 0.0827,
"sample_detector_distance": 2.5,
"concentration_min": null,
"concentration_max": 5.0,
"sample_volume": 100.0,
"flow_rate": 0.15,
"s_min": 0.07,
"s_max": 24.652,
"total_exposure_time": null,
"seccolumn": 49
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDXQ9_fit1_model1_img.png",
"software": "AlphaFold",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDXQ9_fit1_model1.pdb",
"model_mw": 105.4,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": "Catalytic and chitinase C-terminal are crystal structure, while other are AF",
"user": 1240
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDXQ9_fit1_fixed_fit_img.png",
"software": "DAMMIF",
"chi_square_value": 1.207,
"p_value": 0.2106,
"fit_residual_plot": "SASDXQ9_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDXQ9_fit1.fir",
"fit_log": null,
"software_version": null,
"description": ""
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDXQ9_fit2_model1_img.png",
"software": "EOM/RANCH",
"pdb_link": [],
"model_title": null,
"type_of_model": "mix",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDXQ9_fit2_model1.pdb",
"model_mw": null,
"bead_radius": 1.9,
"log": null,
"symmetry": null,
"comment": "RANCH model was generated by both AF and crystal structure of some domains",
"user": 1240
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDXQ9_fit2_model2_img.png",
"software": "EOM/RANCH",
"pdb_link": [],
"model_title": null,
"type_of_model": "mix",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDXQ9_fit2_model2.pdb",
"model_mw": null,
"bead_radius": 1.9,
"log": "https://www.sasbdb.org/media/log_files/logFile_010_1.log",
"symmetry": null,
"comment": null,
"user": 1240
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDXQ9_fit2_model3_img.png",
"software": "EOM/RANCH",
"pdb_link": [],
"model_title": null,
"type_of_model": "mix",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDXQ9_fit2_model3.pdb",
"model_mw": null,
"bead_radius": 1.9,
"log": "https://www.sasbdb.org/media/log_files/logFile_010_1_IQZEnHl.log",
"symmetry": null,
"comment": null,
"user": 1240
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDXQ9_fit2_fixed_fit_img.png",
"software": "EOM/GAJOE",
"chi_square_value": 1.344,
"p_value": 0.5079,
"fit_residual_plot": "SASDXQ9_fit2_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDXQ9_fit2.fit",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/logFile_010_1_couHHMv.log",
"software_version": null,
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": "BioXTAS RAW",
"pddf_software_version": "2.3.0",
"i0_calibration_standard": null,
"description": "The SAS profile obtained by SEC-SAXS connected with Superdex200-increase column size 5x150 mm (Cytiva), flow rate 0.15 mL/min. The 100 µL of 5 mg/mL protein was injected.",
"experiment_description": null,
"tags": [],
"intensity_unit": "1/cm",
"experimental_mw": 107.2,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 103.6,
"porod_mw_error": null,
"pddf_i0": 0.06233594,
"pddf_i0_error": null,
"guinier_i0": 0.129315,
"guinier_i0_error": null,
"pddf_rg": 4.1,
"pddf_rg_error": null,
"guinier_rg": 4.107,
"guinier_rg_error": 0.021,
"pddf_dmax": 17.36,
"pddf_dmax_error": null,
"porod_volume": 125.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 15,
"guinier_point_last": 55,
"pddf_point_first": 11,
"pddf_point_last": 232,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDXQ9_2aWXeaY_datloglog_img.png",
"symmetry": null,
"last_modified": "2026-08-05T11:48:50.892645+02:00",
"bragg_peak": []
}
