The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDXU4",
"status": "Published",
"type_of_curve": "SEC-SAS",
"angular_unit": "1/nm",
"project": {
"title": "Structural and biophysical insights into RomR, MglB and MglC interactions involved in regulating cell polarity in Myxococcus xanthus",
"publication": {
"title": "Structural and biophysical insights into RomR, MglB and MglC interactions involved in regulating cell polarity in Myxococcus xanthus",
"author_list": "Kodesia A, Kapoor S, Thakur K",
"journal": "Journal of Biological Chemistry",
"doi": "10.1016/j.jbc.2025.110907",
"pmid": null,
"published_date": "2025 Nov"
},
"status": "released",
"submitted_date": "2025-05-18",
"released_date": "2025-11-07"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDXU4.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDXU4.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDXU4_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDXU4_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDXU4_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDXU4_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDXU4.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus3 2M",
"resolution": 0.172
},
"name": "ESRF",
"city": "Grenoble",
"country": "France",
"beamline_name": "BM29",
"beam_geometry": "point",
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Two-component system response regulator",
"short_name": "RomR(371-420)",
"sequence": "MDHHHHHHSSGVDLGTENLYFQSASMDGGEALLREALSKASREVIEKIAWEVVPQLAETIIREELERLIKDRETQH",
"organism": "Myxococcus xanthus DK 1622",
"uniprot_code": "A0AAE6G1Y1",
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "trimer",
"molecular_type": "protein",
"uniprot_sequence": "MPKNLLVADDSLTIRKVIGMIFATEDFQVTAVDNGLDAISRTRELRPDVVLADVMMPGKS\nGYEVCEALKNDPATQGIPVVLLAGTFEAFDENRARAARADDHVTKPFESQVLLDKVKALV\nGQKSNTMPASAATQVRHAAPQPVAAPAPVAAAAPPGARPAPPPGARPGVPPGPGVPRPPP\nGAGVPPPGARPPGPGMPPGMARPPGPGMPPPGAPGAPRPPGPGMPPGMARPPGPGVPPGA\nRPPGPGMPPGARPGVPPPPGGSAPGLPPRPGMPPGAVARPGVPPPPGGPAPGGFSRPPVG\nAPQPPPGAAPPPAARGRDPFGLGAPAPAAAQPSISIEDSLPDQGDAEEISLDIATPAPVA\nARPASARAPAADGGEALLREALSKASREVIEKIAWEVVPQLAETIIREELERLIKDRETQ\nH",
"mw": 8.727,
"total_mw": 26.181,
"number_molecules": 3,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": ""
},
{
"long_name": "Mutual gliding motility protein C",
"short_name": "MglC",
"sequence": "MDHHHHHHSSGVDLGTENLYFQSASMSFRTHLESVVNQVEGALACSVMGFDGISVDTFQKDESAELDLNGAWVEYANLLTQLRNAAETLKTGTVSEVSVNSEKVLTVMRLVSPDYFLVLALHADGNFGKGRYVLRVTAPKVRAEL",
"organism": "Myxococcus xanthus (strain DK1622)",
"uniprot_code": "Q1D0B6",
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "dimer",
"molecular_type": "protein",
"uniprot_sequence": "MSFRTHLESVVNQVEGALACSVMGFDGISVDTFQKDESAELDLNGAWVEYANLLTQLRNA\nAETLKTGTVSEVSVNSEKVLTVMRLVSPDYFLVLALHADGNFGKGRYVLRVTAPKVRAEL",
"mw": 15.948,
"total_mw": 31.896,
"number_molecules": 2,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": ""
},
{
"long_name": "Gliding motility protein MglB",
"short_name": "MglB",
"sequence": "MDHHHHHHSSGVDLGTENLYFQSASEFTKINAVCDRLTKDANAKVVFLVDKNGQLISSAGQTQNIDTTSLASLTAGNVAAMGGLAKLIGENEFPNQFHEGAKDSLYMTIVGSRVVLVVIFDNRTSLGLVRLRIKKASDELTKIFESLV",
"organism": "Myxococcus xanthus (strain DK1622)",
"uniprot_code": "Q1DB03",
"uniprot_range_first": 11,
"uniprot_range_last": 133,
"oligomerization": "dimer",
"molecular_type": "protein",
"uniprot_sequence": "MGTQLVMYEEEFTKINAVCDRLTKDANAKVVFLVDKNGQLISSAGQTQNIDTTSLASLTA\nGNVAAMGGLAKLIGENEFPNQFHEGAKDSLYMTIVGSRVVLVVIFDNRTSLGLVRLRIKK\nASDELTKIFESLVKKTDSPGAGSPFAEISDDDIDNLFSE",
"mw": 16.098,
"total_mw": 32.196,
"number_molecules": 2,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": "Gliding motility protein MglB. The protein construct contains an additional 25 non-native amino acids at the N-terminus, including a polyhistidine tag (MDHHHHHHSSGVDLGTENLYFQSAS)."
}
],
"buffer": {
"name": "20 mM HEPES, 150 mM NaCl, 10% glycerol",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 8.0,
"deuteration": null
},
"purity_method": null,
"name": "Mutual gliding motility protein C and B interacting with the C-terminal helix of RomR protein from Myxococcus xanthus",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "CSIR",
"address": "Chandigarh, India",
"full_name": "CSIR-Institute of Microbial Technology",
"webpage": "http://www.imtech.res.in/"
}
],
"contributor_name": "Akriti",
"contributor_surname": "Kodesia",
"orcid": ""
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2023-03-31",
"storage_temperature": -20.0,
"cell_temperature": 4.0,
"exposure_time": 2.0,
"number_of_frames": 750,
"wavelength": 0.0991,
"sample_detector_distance": 2.81,
"concentration_min": null,
"concentration_max": 1.0,
"sample_volume": 50.0,
"flow_rate": 0.6,
"s_min": 0.063,
"s_max": 5.21,
"total_exposure_time": null,
"seccolumn": 34
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDXU4_fit1_model1_img.png",
"software": "GASBOR",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDXU4_fit1_model1.cif",
"model_mw": null,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": null,
"user": 1231
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDXU4_fit1_fixed_fit_img.png",
"software": "GASBOR",
"chi_square_value": 1.79,
"p_value": 0.0,
"fit_residual_plot": "SASDXU4_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDXU4_fit1.fir",
"fit_log": null,
"software_version": null,
"description": ""
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDXU4_SREFLEXmodel_img.png",
"software": "SREFLEX",
"pdb_link": [],
"model_title": "SASDXU4_SREFLEX",
"type_of_model": "dummy",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDXU4_SREFLEXmodel.pdb",
"model_mw": null,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": null,
"user": 196
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDXU4_SREFLEXfit_fixed_fit_img.png",
"software": "SREFLEX",
"chi_square_value": 4.865,
"p_value": 0.0,
"fit_residual_plot": "SASDXU4_SREFLEXfit_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDXU4_SREFLEXfit.fit",
"fit_log": null,
"software_version": null,
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": null,
"experiment_description": null,
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 121.0,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 120.0,
"porod_mw_error": null,
"pddf_i0": 212.3,
"pddf_i0_error": null,
"guinier_i0": 212.453,
"guinier_i0_error": null,
"pddf_rg": 3.794,
"pddf_rg_error": null,
"guinier_rg": 3.79,
"guinier_rg_error": 0.01,
"pddf_dmax": 13.55,
"pddf_dmax_error": null,
"porod_volume": 204.37,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 1,
"guinier_point_last": 55,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDXU4_datloglog_img.png",
"symmetry": null,
"last_modified": "2025-11-12T11:23:47.376377+01:00",
"bragg_peak": []
}
