EGFR kinase domain duplication mutant (KDD) at 2.7 mg/ml

{
  "code": "SASDXW4",
  "status": "Published",
  "type_of_curve": "Single concentration",
  "angular_unit": "1/A",
  "project": {
    "title": "The role of kinase domain dimerization in EGFR activation",
    "publication": null,
    "status": "released",
    "submitted_date": "2025-03-16",
    "released_date": "2025-11-02"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDXW4.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDXW4.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDXW4_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDXW4_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDXW4_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDXW4_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDXW4.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": "Rigaku HyPix - 3000",
        "name": "Rigaku PSAXS Nano",
        "resolution": 100.0
      },
      "name": "Yale University",
      "city": "New Haven",
      "country": "United States",
      "beamline_name": "Rigaku MicroMax-007HF",
      "beam_geometry": null,
      "type_of_source": "X-ray in house",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Receptor protein-tyrosine kinase (duplication mutant)",
          "short_name": "KDD",
          "sequence": "HHHHHHSSGVDLGTENLYFQSMGEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDADEYLIPQQGFFSSPSTSRTPLLSSLLVEPLTPSGEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDADEYLIPQQG",
          "organism": "Homo sapiens",
          "uniprot_code": "Q504U8",
          "uniprot_range_first": 651,
          "uniprot_range_last": 993,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MRPSGTAGAALLALLAALCPASRALEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEV\nVLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNMYYENSYALA\nVLSNYDANKTGLKELPMRNLQGQKCDPSCPNGSCWGAGEENCQKLTKIICAQQCSGRCRG\nKSPSDCCHNQCAAGCTGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKY\nSFGATCVKKCPRNYVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEF\nKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFL\nLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISG\nNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVS\nCRNVSRGRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHY\nIDGPHCVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCPTNGPKIPS\nIATGMVGALLLLLVVALGIGLFMRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLR\nILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYV\nMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGM\nNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALES\nILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYM\nIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEE\nDMDDVVDADEYLIPQQGFFSSPSTSRTPLLSSLSATSNNSTVACIDRNGLQSCPIKEDSF\nLQRYSSDPTGALTEDSIDDTFLPVPGEWLVWKQSCSSTSSTHSAAASLQCPSQVLPPASP\nEGETVADLQTQ",
          "mw": 79.594,
          "total_mw": 79.594,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": "EGFR kinase domain duplication mutant. The purified construct consists of amino acids 643-976 appended to amino acids 651-993 using mature protein numbering (UniProt Q504U8 numbering: 651-993 followed by a duplicated 643-977 region). The protein construct used for SAXS contains an additional N-terminal non-native 22 amino acid extension and polyhistidine tag (HHHHHHSSGVDLGTENLYFQSM)."
        }
      ],
      "buffer": {
        "name": "20 mM HEPES, 250 mM NaCl, 250 mM KCl",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 8.0,
        "deuteration": null
      },
      "purity_method": null,
      "name": "EGFR kinase domain duplication mutant (KDD) at 2.7 mg/ml",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": "New Haven, CT, USA",
            "full_name": "Yale University",
            "webpage": "https://www.yale.edu/"
          }
        ],
        "contributor_name": "Zaritza",
        "contributor_surname": "Petrova",
        "orcid": "https://orcid.org/0000-0002-4877-4676"
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2022-03-22",
    "storage_temperature": 4.0,
    "cell_temperature": 4.0,
    "exposure_time": 7200.0,
    "number_of_frames": 3,
    "wavelength": 0.1542,
    "sample_detector_distance": 0.491,
    "concentration_min": null,
    "concentration_max": 2.7,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.144,
    "s_max": 5.067,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "5.0",
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": "SAXS data from solutions of EGFR kinase domain duplication mutant in 20 mM HEPES, 250 mM NaCl, 250 mM KCl, pH 8 were collected on the Rigaku MicroMax-007HF instrument (Yale University, New Haven, United States) using a Rigaku PSAXS Nano detector at a sample-detector distance of 0.5 m and at a wavelength of λ = 0.1542 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). One solute concentration of 2.70 mg/ml was measured at 4°C. Three successive 7200 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 79.6,
  "experimental_mw_error": null,
  "guinier_i0_mw": 74.8,
  "guinier_i0_mw_error": null,
  "porod_mw": 118.0,
  "porod_mw_error": null,
  "pddf_i0": 0.2453,
  "pddf_i0_error": null,
  "guinier_i0": 0.244433,
  "guinier_i0_error": null,
  "pddf_rg": 4.74,
  "pddf_rg_error": null,
  "guinier_rg": 4.514,
  "guinier_rg_error": 0.414,
  "pddf_dmax": 14.9,
  "pddf_dmax_error": null,
  "porod_volume": 190.0,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 10,
  "guinier_point_last": 28,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDXW4_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2025-11-02T21:11:44.771676+01:00",
  "bragg_peak": []
}

{
  "code": "SASDXW4",
  "status": "success",
  "started_at": "2026-08-11T14:33:26.249864+00:00",
  "finished_at": "2026-08-11T14:33:33.397346+00:00",
  "source_last_modified": "2025-11-02T21:11:44.771676+01:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDXW4/",
      "path": "/data/saxsdb/sasbdb/entries/w4/sasdxw4/source/summary.json",
      "size": 7775,
      "sha256": "ac8060a75788fdb7431766b9c863960a08cb710cb4e5f621cd53202aa70ce14f"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDXW4.dat",
      "path": "/data/saxsdb/sasbdb/entries/w4/sasdxw4/source/SASDXW4.dat",
      "size": 39946,
      "sha256": "cae9369098f414e2ff1546097376d7f55f37a5a53f50c38c2443aa43a870c849",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDXW4.out",
      "path": "/data/saxsdb/sasbdb/entries/w4/sasdxw4/source/SASDXW4.out",
      "size": 31264,
      "sha256": "f21377e47133f1489a7ffcf857e3ba6f5a69c220de70705100f69f2410724bab",
      "role": "pddf"
    },
    {
      "status": "not_available",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDXW4.sascif",
      "path": "/data/saxsdb/sasbdb/entries/w4/sasdxw4/source/SASDXW4.sascif",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDXW4.zip",
      "path": "/data/saxsdb/sasbdb/entries/w4/sasdxw4/source/SASDXW4.zip",
      "size": 23239,
      "sha256": "e60e5aa2c5c760a45513f83a77f13e8eb5753a20b64fa7841417fb112ce038ac",
      "role": "full_entry_zip",
      "zip_member_count": 2,
      "zip_validation": "central_directory_readable"
    }
  ]
}