The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDXX5",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/A",
"project": {
"title": "Phosphorylation toggles the SARS-CoV-2 nucleocapsid protein between two membrane-associated condensate states.",
"publication": {
"title": "Phosphorylation toggles the SARS-CoV-2 nucleocapsid protein between two membrane-associated condensate states.",
"author_list": "Favetta B, Wang H, Cubuk J, Singh A, Barai M, Ramirez C, Zheng H, Gormley AJ, Murthy NS, Dignon G, Soranno A, Shi Z, Schuster BS",
"journal": "Nat Commun",
"doi": "10.1038/s41467-025-62922-4",
"pmid": "40858555",
"published_date": "2025 Aug 26"
},
"status": "released",
"submitted_date": "2025-07-03",
"released_date": "2025-08-19"
},
"pddf_data": null,
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDXX5.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDXX5_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDXX5_kratky_img.png",
"pddf_plot": null,
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDXX5_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDXX5.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "Duel detector",
"name": "Pilatus3 S 1M, Pilatus3 900 K",
"resolution": null
},
"name": "National Synchrotron Light Source II (NSLS-II)",
"city": "Upton, NY",
"country": "USA",
"beamline_name": "16-ID (LiX)",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": true,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Nucleoprotein",
"short_name": null,
"sequence": "MHHHHHHENLYFQGSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA",
"organism": "Severe acute respiratory syndrome coronavirus 2",
"uniprot_code": "P0DTC9",
"uniprot_range_first": 2,
"uniprot_range_last": 419,
"oligomerization": "dimer",
"molecular_type": "protein",
"uniprot_sequence": "MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHG\nKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAG\nLPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYAEGSRGGS\nQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQ\nQQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKH\nWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAY\nKTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA",
"mw": 47.3,
"total_mw": 94.6,
"number_molecules": 2,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": "The protein construct contains an additional 14 non-native amino acids at the N-terminus including a polyhistidine tag (MHHHHHHENLYFQG).\r\nN-terminal His6xtag+tev cleavage site"
}
],
"buffer": {
"name": "20 mM Tris, 150 mM NaCl",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.5,
"deuteration": null
},
"purity_method": null,
"name": "SARS-CoV-2 Nucleocapsid protein 0.5 mg/mL",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": null,
"full_name": "Rutgers University",
"webpage": null
}
],
"contributor_name": "Bruna",
"contributor_surname": "Favetta",
"orcid": "https://orcid.org/0000-0002-3613-1665"
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2023-07-18",
"storage_temperature": 4.0,
"cell_temperature": 25.0,
"exposure_time": 0.5,
"number_of_frames": 10,
"wavelength": 0.08189,
"sample_detector_distance": 3.56,
"concentration_min": null,
"concentration_max": 0.5,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.05,
"s_max": 2.5,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [],
"estimated_volume_method": null,
"pddf_software": "BioXTAS RAW",
"pddf_software_version": null,
"i0_calibration_standard": null,
"description": null,
"experiment_description": "Synchrotron SAXS data from solutions of SARS-CoV-2 Nucleocapsid protein in 20 mM Tris, 150 mM NaCl, pH 7.5 were collected on the 16-ID (LiX) beam line at the National Synchrotron Light Source II (NSLS-II) storage ring (Upton, NY, USA) of λ = 0.08189 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). SAXS data was collected over a s range of 0.05 - 31.3 nm-1 and analyzed within a range of 0.05 - 2.55 nm-1. Sample to detector distance for small angles was 3.560 m and 0.317 m for wide angles using Pilatus3X 1M and Pilatus3X 900k detectors. One solute concentration of 0.50 mg/ml was measured at 25°C. 10 successive 0.500 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 94.6,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": null,
"porod_mw_error": null,
"pddf_i0": 1.1415,
"pddf_i0_error": 0.0023,
"guinier_i0": 1.44685,
"guinier_i0_error": null,
"pddf_rg": 5.713,
"pddf_rg_error": 0.11,
"guinier_rg": 5.768,
"guinier_rg_error": 0.17,
"pddf_dmax": 17.05,
"pddf_dmax_error": 0.99,
"porod_volume": null,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 1,
"guinier_point_last": 19,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDXX5_datloglog_img.png",
"symmetry": null,
"last_modified": "2025-09-01T15:11:14.414737+02:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDXX5",
"status": "success",
"started_at": "2026-08-11T14:58:47.010700+00:00",
"finished_at": "2026-08-11T14:58:52.241664+00:00",
"source_last_modified": "2025-09-01T15:11:14.414737+02:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDXX5/",
"path": "/data/saxsdb/sasbdb/entries/x5/sasdxx5/source/summary.json",
"size": 7066,
"sha256": "562be39cf56f131b01c47c83bb8cd4b76a07194fbc815b788155292a185b3935"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDXX5.dat",
"path": "/data/saxsdb/sasbdb/entries/x5/sasdxx5/source/SASDXX5.dat",
"size": 3333,
"sha256": "4e0068af2e2c96f800f1effe1b251d6274bed3fa9d2fb251368cec3fb7f592a3",
"role": "curve"
},
{
"role": "pddf",
"status": "not_listed",
"path": "/data/saxsdb/sasbdb/entries/x5/sasdxx5/source/SASDXX5.out"
},
{
"status": "not_available",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDXX5.sascif",
"path": "/data/saxsdb/sasbdb/entries/x5/sasdxx5/source/SASDXX5.sascif",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDXX5.zip",
"path": "/data/saxsdb/sasbdb/entries/x5/sasdxx5/source/SASDXX5.zip",
"size": 1052,
"sha256": "470ed72ae2a54d48cec2a3decac1b7ad153e15c8bf68e8d107b45e5f2fda65a4",
"role": "full_entry_zip",
"zip_member_count": 1,
"zip_validation": "central_directory_readable"
}
]
}
