The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDY96",
"status": "Published",
"type_of_curve": "SEC-SAS",
"angular_unit": "1/A",
"project": {
"title": "Structural and biophysical analysis of the four CHRD domains of human chordin reveals a novel binding site for glycosaminoglycans.",
"publication": {
"title": "Structural and biophysical analysis of the four CHRD domains of human chordin reveals a novel binding site for glycosaminoglycans.",
"author_list": "Snee M, Birchenough HL, Becker MH, Popplewell JF, Ashe HL, Baldock C",
"journal": "J Biol Chem",
"doi": "10.1016/j.jbc.2026.113248",
"pmid": "42285510",
"published_date": "2026 Jun 12"
},
"status": "released",
"submitted_date": "2026-01-27",
"released_date": "2026-06-15"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDY96.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDY96.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDY96_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDY96_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDY96_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDY96_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDY96.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Eiger 4M",
"resolution": 75.0
},
"name": "Diamond Light Source",
"city": "Didcot",
"country": "UK",
"beamline_name": "B21",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Chordin fragment aa.168-650",
"short_name": null,
"sequence": "APLAGHTDFVALLTGPRSQAVARARVSLLRSSLRFSISYRRLDRPTRIRFSDSNGSVLFEHPAAPTQDGLVCGVWRAVPRLSLRLLRAEQLHVALVTLTHPSGEVWGPLIRHRALAAETFSAILTLEGPPQQGVGGITLLTLSDTEDSLHFLLLFRGLLEPRSGGLTQVPLRLQILHQGQLLRELQANVSAQEPGFAEVLPNLTVQEMDWLVLGELQMALEWAGRPGLRISGHIAARKSCDVLQSVLCGADALIPVQTGAAGSASLTLLGNGSLIYQVQVVGTSSEVVAMTLETKPQRRDQRTVLCHMAGLQPGGHTAVGICPGLGARGAHMLLQNELFLNVGTKDFPDGELRGHVAALPYCGHSARHDTLPVPLAGALVLPPVKSQAAGHAWLSLDTHCHLHYEVLLAGLGGSEQGTVTAHLLGPPGTPGPRRLLKGFYGSEAQGVVKDLEPELLRHLAKGMASLLITTKGSPRGELRGQVHIANQCELVPRGSHHHHHH",
"organism": "Homo sapiens",
"uniprot_code": "Q9H2X0",
"uniprot_range_first": 168,
"uniprot_range_last": 644,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MPSLPAPPAPLLLLGLLLLGSRPARGAGPEPPVLPIRSEKEPLPVRGAAGCTFGGKVYAL\nDETWHPDLGEPFGVMRCVLCACEAPQWGRRTRGPGRVSCKNIKPECPTPACGQPRQLPGH\nCCQTCPQERSSSERQPSGLSFEYPRDPEHRSYSDRGEPGAEERARGDGHTDFVALLTGPR\nSQAVARARVSLLRSSLRFSISYRRLDRPTRIRFSDSNGSVLFEHPAAPTQDGLVCGVWRA\nVPRLSLRLLRAEQLHVALVTLTHPSGEVWGPLIRHRALAAETFSAILTLEGPPQQGVGGI\nTLLTLSDTEDSLHFLLLFRGLLEPRSGGLTQVPLRLQILHQGQLLRELQANVSAQEPGFA\nEVLPNLTVQEMDWLVLGELQMALEWAGRPGLRISGHIAARKSCDVLQSVLCGADALIPVQ\nTGAAGSASLTLLGNGSLIYQVQVVGTSSEVVAMTLETKPQRRDQRTVLCHMAGLQPGGHT\nAVGICPGLGARGAHMLLQNELFLNVGTKDFPDGELRGHVAALPYCGHSARHDTLPVPLAG\nALVLPPVKSQAAGHAWLSLDTHCHLHYEVLLAGLGGSEQGTVTAHLLGPPGTPGPRRLLK\nGFYGSEAQGVVKDLEPELLRHLAKGMASLMITTKGSPRGELRGQVHIANQCEVGGLRLEA\nAGAEGVRALGAPDTASAAPPVVPGLPALAPAKPGGPGRPRDPNTCFFEGQQRPHGARWAP\nNYDPLCSLCTCQRRTVICDPVVCPPPSCPHPVQAPDQCCPVCPEKQDVRDLPGLPRSRDP\nGEGCYFDGDRSWRAAGTRWHPVVPPFGLIKCAVCTCKGGTGEVHCEKVQCPRLACAQPVR\nVNPTDCCKQCPVGSGAHPQLGDPMQADGPRGCRFAGQWFPESQSWHPSVPPFGEMSCITC\nRCGAGVPHCERDDCSLPLSCGSGKESRCCSRCTAHRRPAPETRTDPELEKEAEGS",
"mw": 53.6,
"total_mw": 53.6,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": ""
}
],
"buffer": {
"name": "25 mM HEPES, 150 mM NaCl",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.5,
"deuteration": null
},
"purity_method": null,
"name": "Chordin fragment aa.168-650",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "Manchester, UK",
"full_name": "University of Manchester",
"webpage": "http://www.manchester.ac.uk/"
}
],
"contributor_name": "Mark H.",
"contributor_surname": "Becker",
"orcid": "https://orcid.org/0000-0003-3474-2419"
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2024-07-26",
"storage_temperature": -80.0,
"cell_temperature": 15.0,
"exposure_time": 1.0,
"number_of_frames": 600,
"wavelength": 0.09464,
"sample_detector_distance": 3.6883,
"concentration_min": null,
"concentration_max": 9.0,
"sample_volume": 50.0,
"flow_rate": 0.07,
"s_min": 0.045,
"s_max": 3.4,
"total_exposure_time": null,
"seccolumn": 48
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDY96_fit1_model1_img.png",
"software": "MultiFoXS",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": "multi_state_model_2_1_1.dat",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDY96_fit1_model1.pdb",
"model_mw": 50.99,
"bead_radius": null,
"log": null,
"symmetry": "C1",
"comment": null,
"user": 1151
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDY96_fit1_model2_img.png",
"software": "MultiFoXS",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": "multi_state_model_2_1_1.dat",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDY96_fit1_model2.pdb",
"model_mw": 50.99,
"bead_radius": null,
"log": null,
"symmetry": "C1",
"comment": null,
"user": 1151
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDY96_fit1_fitfoxs_img.png",
"software": "MultiFoXS",
"chi_square_value": 2.054974,
"p_value": 0.0,
"fit_residual_plot": "SASDY96_fit1_fitfoxsresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDY96_fit1.dat",
"fit_log": null,
"software_version": "main.af0ac5f",
"description": ""
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDY96_fit2_model1_img.png",
"software": "MultiFoXS",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": "main.af0ac5f",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDY96_fit2_model1.pdb",
"model_mw": 50.99,
"bead_radius": null,
"log": null,
"symmetry": "C1",
"comment": null,
"user": 1151
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDY96_fit2_fitfoxs_img.png",
"software": "MultiFoXS",
"chi_square_value": 2.277442,
"p_value": 0.0,
"fit_residual_plot": "SASDY96_fit2_fitfoxsresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDY96_fit2.dat",
"fit_log": null,
"software_version": "main.af0ac5f",
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": null,
"experiment_description": null,
"tags": [],
"intensity_unit": "1/cm",
"experimental_mw": 61.3,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 66.0,
"porod_mw_error": null,
"pddf_i0": 0.1159,
"pddf_i0_error": null,
"guinier_i0": 0.115845,
"guinier_i0_error": null,
"pddf_rg": 2.98,
"pddf_rg_error": null,
"guinier_rg": 2.962,
"guinier_rg_error": 0.02,
"pddf_dmax": 10.57,
"pddf_dmax_error": null,
"porod_volume": 106.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 40,
"guinier_point_last": 302,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDY96_datloglog_img.png",
"symmetry": null,
"last_modified": "2026-06-15T09:04:33.907949+02:00",
"bragg_peak": []
}
