The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDYL2",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/A",
"project": {
"title": "Prothrombin recognition and conformational modulation by anti-thrombin anticoagulant aptamers.",
"publication": {
"title": "Prothrombin recognition and conformational modulation by anti-thrombin anticoagulant aptamers.",
"author_list": "Troisi R, Cangiano A, Cowieson N, Spiridonova V, Pozzi N, Del Vecchio P, Paduano L, Sica F",
"journal": "Mol Ther",
"doi": "10.1016/j.ymthe.2026.07.042",
"pmid": "42494063",
"published_date": "2026 Jul 23"
},
"status": "released",
"submitted_date": "2025-11-08",
"released_date": "2026-07-29"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDYL2.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDYL2.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDYL2_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDYL2_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDYL2_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDYL2_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDYL2.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Eiger 4M",
"resolution": 75.0
},
"name": "Diamond Light Source",
"city": "Didcot",
"country": "UK",
"beamline_name": "B21",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Human prothrombin",
"short_name": null,
"sequence": "ANTFLEEVRKGNLERECVEETCSYEEAFEALESSTATDVFWAKYTACETARTPRDKLAACLEGNCAEGLGTNYRGHVNITRSGIECQLWRSRYPHKPEINSTTHPGADLQENFCRNPDSSTTGPWCYTTDPTVRRQECSIPVCGQDQVTVAMTPRSEGSSVNLSPPLEQCVPDRGQQYQGRLAVTTHGLPCLAWASAQAKALSKHQDFNSAVQLVENFCRNPDGDEEGVWCYVAGKPGDFGYCDLNYCEEAVEEETGDGLDEDSDRAIEGRTATSEYQTFFNPRTFGSGEADCGLRPLFEKKSLEDKTERELLESYIDGRIVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETWTANVGKGQPSVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQFGE",
"organism": "Homo sapiens",
"uniprot_code": "P00734",
"uniprot_range_first": 44,
"uniprot_range_last": 622,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MAHVRGLQLPGCLALAALCSLVHSQHVFLAPQQARSLLQRVRRANTFLEEVRKGNLEREC\nVEETCSYEEAFEALESSTATDVFWAKYTACETARTPRDKLAACLEGNCAEGLGTNYRGHV\nNITRSGIECQLWRSRYPHKPEINSTTHPGADLQENFCRNPDSSTTGPWCYTTDPTVRRQE\nCSIPVCGQDQVTVAMTPRSEGSSVNLSPPLEQCVPDRGQQYQGRLAVTTHGLPCLAWASA\nQAKALSKHQDFNSAVQLVENFCRNPDGDEEGVWCYVAGKPGDFGYCDLNYCEEAVEEETG\nDGLDEDSDRAIEGRTATSEYQTFFNPRTFGSGEADCGLRPLFEKKSLEDKTERELLESYI\nDGRIVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTEN\nDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIALMKLKKPVAFSDYIHP\nVCLPDRETAASLLQAGYKGRVTGWGNLKETWTANVGKGQPSVLQVVNLPIVERPVCKDST\nRIRITDNMFCAGYKPDEGKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKY\nGFYTHVFRLKKWIQKVIDQFGE",
"mw": 72.0,
"total_mw": 72.0,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": ""
}
],
"buffer": {
"name": "10 mM Tris-HCl, 137 mM NaCl, 2.7 mM KCl, 5 mM CaCl2, 1% v/v glycerol,",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.4,
"deuteration": null
},
"purity_method": null,
"name": "Human prothrombin in the unbound state",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": null,
"full_name": "University of Naples Federico II",
"webpage": null
}
],
"contributor_name": "Romualdo",
"contributor_surname": "Troisi",
"orcid": "https://orcid.org/0000-0002-3484-3589"
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2022-04-29",
"storage_temperature": 4.0,
"cell_temperature": 20.0,
"exposure_time": 1.0,
"number_of_frames": 21,
"wavelength": 0.095,
"sample_detector_distance": 3.7,
"concentration_min": null,
"concentration_max": 0.22,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.045,
"s_max": 3.4,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDYL2_fit1_model1_img.png",
"software": "MultiFoXS",
"pdb_link": [
{
"pdb_code": "5edm",
"ext_code": "5EDM",
"ext_type": "pdb",
"difference_with_model": "identical"
}
],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDYL2_fit1_model1.pdb",
"model_mw": 65.29,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": "Human prothrombin in the open conformation",
"user": 1290
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDYL2_fit1_fixed_fit_img.png",
"software": "FoXS",
"chi_square_value": 0.123468,
"p_value": 0.7151,
"fit_residual_plot": "SASDYL2_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDYL2_fit1.fit",
"fit_log": null,
"software_version": null,
"description": ""
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDYL2_fit2_model1_img.png",
"software": "MultiFoXS",
"pdb_link": [
{
"pdb_code": "6c2w",
"ext_code": "6C2W",
"ext_type": "pdb",
"difference_with_model": "identical"
}
],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDYL2_fit2_model1.pdb",
"model_mw": 65.29,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": "Human prothrombin in the closed conformation",
"user": 1290
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDYL2_fit2_fixed_fit_img.png",
"software": "FoXS",
"chi_square_value": 0.123944,
"p_value": 0.7151,
"fit_residual_plot": "SASDYL2_fit2_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDYL2_fit2.fit",
"fit_log": null,
"software_version": null,
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "3.1.0",
"i0_calibration_standard": null,
"description": null,
"experiment_description": null,
"tags": [],
"intensity_unit": "1/cm",
"experimental_mw": 67.089,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 77.0,
"porod_mw_error": null,
"pddf_i0": 0.01433,
"pddf_i0_error": null,
"guinier_i0": 0.0144486,
"guinier_i0_error": null,
"pddf_rg": 3.41,
"pddf_rg_error": 0.12,
"guinier_rg": 3.42,
"guinier_rg_error": 0.01,
"pddf_dmax": 12.0,
"pddf_dmax_error": null,
"porod_volume": 123.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 2,
"guinier_point_last": 169,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDYL2_datloglog_img.png",
"symmetry": null,
"last_modified": "2026-07-29T11:49:25.434245+02:00",
"bragg_peak": []
}
