The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDYN9",
"status": "Published",
"type_of_curve": "SEC-SAS",
"angular_unit": "1/nm",
"project": {
"title": "Conformational dynamics of the membrane-anchored foldase LipH from Pseudomonas aeruginosa governs recognition and release of its client lipase",
"publication": {
"title": "Conformational dynamics of the membrane-anchored foldase LipH from Pseudomonas aeruginosa governs recognition and release of its client lipase",
"author_list": "Busch M, Loschwitz J, Papadopoulos A, Reiners J, Steinchen W, Calvagna V, Smits S, Jaeger K, Kedrov A",
"journal": "Journal of Biological Chemistry",
"doi": "10.1016/j.jbc.2026.113266",
"pmid": null,
"published_date": "2026 Jun"
},
"status": "released",
"submitted_date": "2026-03-08",
"released_date": "2026-06-09"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDYN9.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDYN9.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDYN9_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDYN9_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDYN9_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDYN9_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDYN9.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus 6M",
"resolution": null
},
"name": "PETRA III",
"city": "DESY; Hamburg",
"country": "Germany",
"beamline_name": "EMBL P12",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Lipase chaperone",
"short_name": "LipH VD",
"sequence": "MGHHHHHHHHHHSSGHIDDDDKHMWLEPSPAPETAPPASPQAGAVHAPPAASAGEAVPAPQVMPAKVAPLPTSFRGTSVDGSFSVDASGNLLITRDIRNLFDYFLSAVGEEPLQQSLDRLRAYIAAELQEPARGQALALMQQYIDYKKELVLLERDLPRLADLDALRQREAAVKALRARIFSNEAHVAFFADEETYNQFTLERLAIRQDGKLSAEEKAAAIDRLRASLPEDQQESVLPQLQSELQQQTAALQAAGAGPEAIRQMRQQLVGAEATTRLEQLDRQRSAWKGRLDDYFAEKSRIEGNTGLSEADRRAAVERLAEERFSEQERLRLGALEQMRQAEQR",
"organism": "Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)",
"uniprot_code": "Q01725",
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MKKILLLIPLAFAASLAWFVWLEPSPAPETAPPASPQAGADRAPPAASAGEAVPAPQVMP\nAKVAPLPTSFRGTSVDGSFSVDASGNLLITRDIRNLFDYFLSAVGEEPLQQSLDRLRAYI\nAAELQEPARGQALALMQQYIDYKKELVLLERDLPRLADLDALRQREAAVKALRARIFSNE\nAHVAFFADEETYNQFTLERLAIRQDGKLSAEEKAAAIDRLRASLPEDQQESVLPQLQSEL\nQQQTAALQAAGAGPEAIRQMRQQLVGAEATTRLEQLDRQRSAWKGRLDDYFAEKSRIEGN\nTGLSEADRRAAVERLAEERFSEQERLRLGALEQMRQAEQR",
"mw": 38.321,
"total_mw": 38.321,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": "LipH without the N-terminal transmembrane helix."
},
{
"long_name": "Triacylglycerol lipase",
"short_name": "LipA",
"sequence": "STYTQTKYPIVLAHGMLGFDNILGVDYWFGIPSALRRDGAQVYVTEVSQLDTSEVRGEQLLQQVEEIVALSGQPKVNLIGHSHGGPTIRYVAAVRPDLIASATSVGAPHKGSDTADFLRQIPPGSAGEAVLSGLVNSLGALISFLSSGSTGTQNSLGSLESLNSEGAARFNAKYPQGIPTSACGEGAYKVNGVSYYSWSGSSPLTNFLDPSDAFLGASSLTFKNGTANDGLVGTCSSHLGMVIRDNYRMNHLDEVNQVFGLTSLFETSPVSVYRQHANRLKNASL",
"organism": "Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)",
"uniprot_code": "P26876",
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MKKKSLLPLGLAIGLASLAASPLIQASTYTQTKYPIVLAHGMLGFDNILGVDYWFGIPSA\nLRRDGAQVYVTEVSQLDTSEVRGEQLLQQVEEIVALSGQPKVNLIGHSHGGPTIRYVAAV\nRPDLIASATSVGAPHKGSDTADFLRQIPPGSAGEAVLSGLVNSLGALISFLSSGSTGTQN\nSLGSLESLNSEGAARFNAKYPQGIPTSACGEGAYKVNGVSYYSWSGSSPLTNFLDPSDAF\nLGASSLTFKNGTANDGLVGTCSSHLGMVIRDNYRMNHLDEVNQVFGLTSLFETSPVSVYR\nQHANRLKNASL",
"mw": 30.135,
"total_mw": 30.135,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": ""
}
],
"buffer": {
"name": "5 mM Tris, 5 mM glycine, 1 mM CaCl2, 5% glycerol,",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 9.0,
"deuteration": null
},
"purity_method": null,
"name": "Lipase chaperone (LipH) VD : Triacylglycerol lipase (LipA) complex",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "Düsseldorf, Germany",
"full_name": "Heinrich Heine University Düsseldorf",
"webpage": "https://www.uni-duesseldorf.de"
}
],
"contributor_name": "Jens",
"contributor_surname": "Reiners",
"orcid": ""
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2022-09-14",
"storage_temperature": 20.0,
"cell_temperature": 20.0,
"exposure_time": 0.995,
"number_of_frames": 2400,
"wavelength": 0.124,
"sample_detector_distance": 3.0,
"concentration_min": null,
"concentration_max": 8.0,
"sample_volume": 100.0,
"flow_rate": 0.6,
"s_min": 0.173,
"s_max": 4.36,
"total_exposure_time": null,
"seccolumn": 1
},
"fits": [
{
"models": [],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDYN9_fit1_fixed_fit_img.png",
"software": "EOM/GAJOE",
"chi_square_value": 1.136,
"p_value": 0.1664,
"fit_residual_plot": "SASDYN9_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDYN9_fit1.fit",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/Size_distr_001_1_sA7XvdK.txt",
"software_version": "GAJOE - version 2.1 - (r13837)",
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": null,
"experiment_description": null,
"tags": [],
"intensity_unit": "1/cm",
"experimental_mw": 68.07,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 68.0,
"porod_mw_error": null,
"pddf_i0": 0.02074,
"pddf_i0_error": null,
"guinier_i0": 0.0205304,
"guinier_i0_error": null,
"pddf_rg": 3.262,
"pddf_rg_error": null,
"guinier_rg": 3.14,
"guinier_rg_error": 0.01,
"pddf_dmax": 11.82,
"pddf_dmax_error": null,
"porod_volume": 110.09,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 1,
"guinier_point_last": 85,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDYN9_datloglog_img.png",
"symmetry": null,
"last_modified": "2026-06-25T14:59:43.063500+02:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDYN9",
"status": "success",
"started_at": "2026-08-11T16:19:01.207119+00:00",
"finished_at": "2026-08-11T16:19:11.162214+00:00",
"source_last_modified": "2026-06-25T14:59:43.063500+02:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDYN9/",
"path": "/data/saxsdb/sasbdb/entries/n9/sasdyn9/source/summary.json",
"size": 8133,
"sha256": "2981de28fe46b267913a510a1dc2688d2504c46f9dfb1dc89635c01ce1ebe570"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDYN9.dat",
"path": "/data/saxsdb/sasbdb/entries/n9/sasdyn9/source/SASDYN9.dat",
"size": 69076,
"sha256": "c8982db2f24664cba02c3ae9673055dfc6690930e3f6be3187aea77b17b582fb",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDYN9.out",
"path": "/data/saxsdb/sasbdb/entries/n9/sasdyn9/source/SASDYN9.out",
"size": 124589,
"sha256": "d4d9c84ac1978f6f3828153f9e3a3f249b404de39ab97ceade0ae9c228247705",
"role": "pddf"
},
{
"status": "not_available",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDYN9.sascif",
"path": "/data/saxsdb/sasbdb/entries/n9/sasdyn9/source/SASDYN9.sascif",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDYN9.zip",
"path": "/data/saxsdb/sasbdb/entries/n9/sasdyn9/source/SASDYN9.zip",
"size": 76262,
"sha256": "f14d1280cba42d608555ca80f429253b11b4201afcdf08424ddf3ee3653d1941",
"role": "full_entry_zip",
"zip_member_count": 4,
"zip_validation": "central_directory_readable"
}
]
}
