The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDZ86",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/A",
"project": {
"title": "Conserved dimerization architecture in C-type lectins from virus-vector mosquitoes",
"publication": null,
"status": "released",
"submitted_date": "2026-05-05",
"released_date": "2026-05-05"
},
"pddf_data": null,
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDZ86.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDZ86_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDZ86_kratky_img.png",
"pddf_plot": null,
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDZ86_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDZ86.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Eiger 4M",
"resolution": 75.0
},
"name": "Diamond Light Source",
"city": "Didcot",
"country": "UK",
"beamline_name": "B21",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "mosGCTL-3",
"short_name": null,
"sequence": "QPICSDKPTSFFIPNKRTNWIGAVEYCNRMDMRLAVISSEAKNVAVLETIQSARANGWKLSNVWIGANDISMEGKFIWHATGQPVNYTNWALNMPDDLQDEDCVEIAYQEYTQWTWKWNDNTCDFMYNFVCESDFLSRCGNNDSIQEFKHHHHHH",
"organism": "Aedes aegypti",
"uniprot_code": null,
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "dimer",
"molecular_type": "protein",
"uniprot_sequence": "",
"mw": 18.125,
"total_mw": 36.25,
"number_molecules": 2,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": "Soluble C-type lectin from Aedes aegypti. Full amino acid sequence was determined by 5′-rapid amplification of cDNA ends, described in doi: 10.1371/journal.ppat.1003931. Protein was expressed in Sf9 cells. His-tag is present."
}
],
"buffer": {
"name": "20 mM Tris, 250 mM NaCl, 2.5 mM CaCl2",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.5,
"deuteration": null
},
"purity_method": null,
"name": "C-type lectin mosGCTL-3 from Aedes aegypti, ~0.45 mg/ml",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": null,
"full_name": "Umeå University",
"webpage": null
}
],
"contributor_name": "Max",
"contributor_surname": "Renner",
"orcid": ""
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2020-12-17",
"storage_temperature": 4.0,
"cell_temperature": 15.0,
"exposure_time": null,
"number_of_frames": 20,
"wavelength": 0.1,
"sample_detector_distance": 3.7,
"concentration_min": null,
"concentration_max": 0.45,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.079,
"s_max": 3.4,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDZ86_fit1_model1_img.png",
"software": "GROMACS",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": "5",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDZ86_fit1_model1.pdb",
"model_mw": 37.89,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": null,
"user": 1345
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDZ86_fit1_model2_img.png",
"software": "GROMACS",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": "5",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDZ86_fit1_model2.pdb",
"model_mw": 37.89,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": null,
"user": 1345
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDZ86_fit1_model3_img.png",
"software": "GROMACS",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": "5",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDZ86_fit1_model3.pdb",
"model_mw": 37.89,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": null,
"user": 1345
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDZ86_fit1_fixed_fit_img.png",
"software": "EOM/GAJOE",
"chi_square_value": 0.767,
"p_value": 0.6623,
"fit_residual_plot": "SASDZ86_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDZ86_fit1.fit",
"fit_log": null,
"software_version": null,
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": null,
"pddf_software_version": null,
"i0_calibration_standard": null,
"description": null,
"experiment_description": null,
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 40.0,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": null,
"porod_mw_error": null,
"pddf_i0": null,
"pddf_i0_error": null,
"guinier_i0": 0.0138243,
"guinier_i0_error": null,
"pddf_rg": null,
"pddf_rg_error": null,
"guinier_rg": 2.4,
"guinier_rg_error": 0.14,
"pddf_dmax": null,
"pddf_dmax_error": null,
"porod_volume": null,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 30,
"guinier_point_last": 351,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDZ86_datloglog_img.png",
"symmetry": null,
"last_modified": "2026-05-05T17:31:42.220040+02:00",
"bragg_peak": []
}
