Schistosoma mansoni Venom Allergen-like protein isoform 11 (SmVAL11) - Cleaved domains

{
  "code": "SASDZJ8",
  "status": "Published",
  "type_of_curve": "SEC-SAS",
  "angular_unit": "1/A",
  "project": {
    "title": "Schistosoma mansoni Venom Allergen-like protein 11 (SmVAL11) in complex with cognate polyclonal antibody (pAb anti-SmVAL11)",
    "publication": null,
    "status": "released",
    "submitted_date": "2026-05-18",
    "released_date": "2026-07-28"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDZJ8.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDZJ8.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDZJ8_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDZJ8_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDZJ8_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDZJ8_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDZJ8.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": null,
        "name": "Eiger 4M",
        "resolution": 75.0
      },
      "name": "SOLEIL",
      "city": "Saint-Aubin",
      "country": "France",
      "beamline_name": "SWING",
      "beam_geometry": null,
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Venom Allergen-like protein 11",
          "short_name": "SmVAL11",
          "sequence": "MSRLDDFREDCFRAHNEKRLLHGVCALRHSLALDKTAQDWAEALLSEDGIKNSPLSSRGEVGESISVRTSTGTHVDMQGHEVVNTWHSDAENYNYENGKGPAGNFTQLVWSSTREVGFGKACGPGKCVVVAHYRPPGNVLGRYLENVFRPKKSVKDVKQPIRNTFALNNDTPKTVITETLTESDGKQYSVRREISDLTDDKGKNKKLYLVGQGKKVEYFSCCFNNRTRRCINEVYTDACKEQKKAKSSISPDGHLVDNSKKLQESIHSVVQLHNQYRSQHGSNPLVLDQNLSNMAQQWADHLLQQSHLSNSGYVYRGMKVGENLGSRWSNGPMELNCKDLIEHWYQESGKYKFNSEPDSIQGIGNFTQIVWTSSERIGVGIAIQSYKSGEDLHKDSKMILVCLYHPPGNVISQFQNNVKKAIK",
          "organism": "Schistosoma mansoni",
          "uniprot_code": "Q1WL54",
          "uniprot_range_first": 1,
          "uniprot_range_last": 423,
          "oligomerization": "other",
          "molecular_type": "protein",
          "uniprot_sequence": "MSRLDDFREDCFRAHNEKRLLHGVCALRHSLALDKTAQDWAEALLSEDGIKNSPLSSRGE\nVGESISVRTSTGTHVDMQGHEVVNTWHSDAENYNYENGKGPAGNFTQLVWSSTREVGFGK\nACGPGKCVVVAHYRPPGNVLGRYLENVFRPKKSVKDVKQPIRNTFALNNDTPKTVITETL\nTESDGKQYSVRREISDLTDDKGKNKKLYLVGQGKKVEYFSCCFNNRTRRCINEVYTDACK\nEQKKAKSSISPDGHLVDNSKKLQESIHSVVQLHNQYRSQHGSNPLVLDQNLSNMAQQWAD\nHLLQQSHLSNSGYVYRGMKVGENLGSRWSNGPMELNCKDLIEHWYQESGKYKFNSEPDSI\nQGIGNFTQIVWTSSERIGVGIAIQSYKSGEDLHKDSKMILVCLYHPPGNVISQFQNNVKK\nAIK",
          "mw": 47.0,
          "total_mw": 47.0,
          "number_molecules": 3,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": "Schistosoma mansoni Venom Allergen-like protein 11 (SmVAL11) is a 47 kDa protein composed by two symmetrical domains  separated by a flexible linker. The latter, in our experience, undergoes autocleavage in vitro, with an unknown mechanism."
        }
      ],
      "buffer": {
        "name": "25 mM MES, 125 mM NaCl, 1 mM EDTA",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 6.8,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Schistosoma mansoni Venom Allergen-like protein isoform 11 (SmVAL11) - Cleaved domains",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": null,
            "full_name": "University of Lyon",
            "webpage": null
          }
        ],
        "contributor_name": "Adriana Erica",
        "contributor_surname": "Miele",
        "orcid": "http://orcid.org/0000-0002-4637-2606"
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2024-07-11",
    "storage_temperature": 4.0,
    "cell_temperature": 20.0,
    "exposure_time": 1.0,
    "number_of_frames": 2400,
    "wavelength": 0.76,
    "sample_detector_distance": 2.0,
    "concentration_min": null,
    "concentration_max": 11.0,
    "sample_volume": 45.0,
    "flow_rate": 0.3,
    "s_min": 0.041,
    "s_max": 5.529,
    "total_exposure_time": null,
    "seccolumn": 48
  },
  "fits": [
    {
      "models": [],
      "fit_unit": "1/A",
      "fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDZJ8_fit1_fixed_fit_img.png",
      "software": "DAMMIF",
      "chi_square_value": 5.258,
      "p_value": 0.0065,
      "fit_residual_plot": "SASDZJ8_fit1_fitresiduals_img.png",
      "fit_data": "https://www.sasbdb.org/media/fitting_files/SASDZJ8_fit1.fir",
      "fit_log": null,
      "software_version": null,
      "description": ""
    }
  ],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "5.0",
  "i0_calibration_standard": null,
  "description": "SmVAL11 is a 45 kDa protein containing two SCP/TAPS domains arranged in tandem and connected by a flexible linker. The protein is prone to autocleavage at the linker region, resulting in a heterogeneous sample containing multiple species in solution. To address this, SAXS measurements were coupled to Size Exclusion Chromatography (SEC-SAXS) to separate and individually analyse the different populations.\r\nThe scattering data presented here were obtained by Evolving Factor Analysis (EFA) deconvolution of the 2nd most intense elution peak, as implemented in RAW, and likely correspond to the cleaved domains of SmVAL11 protein.",
  "experiment_description": null,
  "tags": [],
  "intensity_unit": null,
  "experimental_mw": 18.1,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": 24100.0,
  "porod_mw_error": null,
  "pddf_i0": 0.2548,
  "pddf_i0_error": null,
  "guinier_i0": 0.299238,
  "guinier_i0_error": null,
  "pddf_rg": 2.02,
  "pddf_rg_error": null,
  "guinier_rg": 2.216,
  "guinier_rg_error": 0.008,
  "pddf_dmax": 7.0,
  "pddf_dmax_error": null,
  "porod_volume": 20.0,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 48,
  "guinier_point_last": 125,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDZJ8_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2026-07-28T14:42:50.979746+02:00",
  "bragg_peak": []
}

{
  "code": "SASDZJ8",
  "status": "success",
  "started_at": "2026-08-11T15:54:50.976440+00:00",
  "finished_at": "2026-08-11T15:54:58.940271+00:00",
  "source_last_modified": "2026-07-28T14:42:50.979746+02:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDZJ8/",
      "path": "/data/saxsdb/sasbdb/entries/j8/sasdzj8/source/summary.json",
      "size": 7097,
      "sha256": "5020a83b8e68b1d6b20517c11193145fb90aa55ee317330a2dd833877ab33894"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDZJ8.dat",
      "path": "/data/saxsdb/sasbdb/entries/j8/sasdzj8/source/SASDZJ8.dat",
      "size": 58638,
      "sha256": "5c247ec3d7e5b76f9b52210c83b4b98f0676ca69212b8d5331ad61ebb6bbe378",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDZJ8.out",
      "path": "/data/saxsdb/sasbdb/entries/j8/sasdzj8/source/SASDZJ8.out",
      "size": 81655,
      "sha256": "3c22197ab528ca29ba9d6b7dc6384e7a445b381087ac95c2705a808fc884a143",
      "role": "pddf"
    },
    {
      "status": "not_available",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDZJ8.sascif",
      "path": "/data/saxsdb/sasbdb/entries/j8/sasdzj8/source/SASDZJ8.sascif",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDZJ8.zip",
      "path": "/data/saxsdb/sasbdb/entries/j8/sasdzj8/source/SASDZJ8.zip",
      "size": 55790,
      "sha256": "a4baa2f2c77f3c8afaca6cb32bbabb6efd61a6987df7cf7ac38679eb3691921a",
      "role": "full_entry_zip",
      "zip_member_count": 3,
      "zip_validation": "central_directory_readable"
    }
  ]
}