The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDZU5",
"status": "Published",
"type_of_curve": "SEC-SAS",
"angular_unit": "1/A",
"project": {
"title": "The Rho guanine-nucleotide exchange factor P-Rex2 exhibits structural and regulatory features distinct from the related RhoGEF P-Rex1",
"publication": {
"title": "The Rho guanine-nucleotide exchange factor P-Rex2 exhibits structural and regulatory features distinct from the related RhoGEF P-Rex1",
"author_list": "Anderson L, Marde R, Muma G, Nayak V, Phan C, Li S, Cash J",
"journal": "Journal of Biological Chemistry",
"doi": "10.1016/j.jbc.2026.113229",
"pmid": null,
"published_date": "2026 Jul"
},
"status": "released",
"submitted_date": "2026-04-03",
"released_date": "2026-07-23"
},
"pddf_data": null,
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDZU5.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDZU5_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDZU5_kratky_img.png",
"pddf_plot": null,
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDZU5_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDZU5.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus3 X 2M",
"resolution": 172.0
},
"name": "Advanced Light Source (ALS)",
"city": "Berkeley, CA",
"country": "USA",
"beamline_name": "12.3.1 (SIBYLS)",
"beam_geometry": "",
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 DH/PH-DEP1",
"short_name": "P-Rex2 DH/PH-DEP1",
"sequence": "GAMDPMSEDSRGDSRAESAKDLEKQLRLRVCVLSELQKTERDYVGTLEFLVSAFLHRMNQCAASKVDKNVTEETVKMLFSNIEDILAVHKEFLKVVEECLHPEPNAQQEVGTCFLHFKDKFRIYDEYCSNHEKAQKLLLELNKIRTIRTFLLNCMLLGGRKNTDVPLEGYLVTPIQRICKYPLILKELLKRTPRKHSDYAAVMEALQAMKAVCSNINEAKRQMEKLEVLEEWQSHIEGWEGSNITDTCTEMLMCGVLLKISSGNIQERVFFLFDNLLVYCKRKHRRLKNSKASTDGHRYLFRGRINTEVMEVENVDDGTADFHSSGHIVVNGWKIHNTAKNKWFVCMAKTPEEKHEWFEAILKERERRKGLKLGMEQDTWVMISEQGEKLYKMMCRQGNLIKDRKRKLTTFPKCFLGSEFVSWLLEIGEIHRPEEGVHLGQALLENGIIHHVTDKHQFKPEQMLYRFRYDDG",
"organism": "Homo sapiens",
"uniprot_code": "Q70Z35",
"uniprot_range_first": 1,
"uniprot_range_last": 467,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MSEDSRGDSRAESAKDLEKQLRLRVCVLSELQKTERDYVGTLEFLVSAFLHRMNQCAASK\nVDKNVTEETVKMLFSNIEDILAVHKEFLKVVEECLHPEPNAQQEVGTCFLHFKDKFRIYD\nEYCSNHEKAQKLLLELNKIRTIRTFLLNCMLLGGRKNTDVPLEGYLVTPIQRICKYPLIL\nKELLKRTPRKHSDYAAVMEALQAMKAVCSNINEAKRQMEKLEVLEEWQSHIEGWEGSNIT\nDTCTEMLMCGVLLKISSGNIQERVFFLFDNLLVYCKRKHRRLKNSKASTDGHRYLFRGRI\nNTEVMEVENVDDGTADFHSSGHIVVNGWKIHNTAKNKWFVCMAKTPEEKHEWFEAILKER\nERRKGLKLGMEQDTWVMISEQGEKLYKMMCRQGNLIKDRKRKLTTFPKCFLGSEFVSWLL\nEIGEIHRPEEGVHLGQALLENGIIHHVTDKHQFKPEQMLYRFRYDDGTFYPRNEMQDVIS\nKGVRLYCRLHSLFTPVIRDKDYHLRTYKSVVMANKLIDWLIAQGDCRTREEAMIFGVGLC\nDNGFMHHVLEKSEFKDEPLLFRFFSDEEMEGSNMKHRLMKHDLKVVENVIAKSLLIKSNE\nGSYGFGLEDKNKVPIIKLVEKGSNAEMAGMEVGKKIFAINGDLVFMRPFNEVDCFLKSCL\nNSRKPLRVLVSTKPRETVKIPDSADGLGFQIRGFGPSVVHAVGRGTVAAAAGLHPGQCII\nKVNGINVSKETHASVIAHVTACRKYRRPTKQDSIQWVYNSIESAQEDLQKSHSKPPGDEA\nGDAFDCKVEEVIDKFNTMAIIDGKKEHVSLTVDNVHLEYGVVYEYDSTAGIKCNVVEKMI\nEPKGFFSLTAKILEALAKSDEHFVQNCTSLNSLNEVIPTDLQSKFSALCSERIEHLCQRI\nSSYKKFSRVLKNRAWPTFKQAKSKISPLHSSDFCPTNCHVNVMEVSYPKTSTSLGSAFGV\nQLDSRKHNSHDKENKSSEQGKLSPMVYIQHTITTMAAPSGLSLGQQDGHGLRYLLKEEDL\nETQDIYQKLLGKLQTALKEVEMCVCQIDDLLSSITYSPKLERKTSEGIIPTDSDNEKGER\nNSKRVCFNVAGDEQEDSGHDTISNRDSYSDCNSNRNSIASFTSICSSQCSSYFHSDEMDS\nGDELPLSVRISHDKQDKIHSCLEHLFSQVDSITNLLKGQAVVRAFDQTKYLTPGRGLQEF\nQQEMEPKLSCPKRLRLHIKQDPWNLPSSVRTLAQNIRKFVEEVKCRLLLALLEYSDSETQ\nLRRDMVFCQTLVATVCAFSEQLMAALNQMFDNSKENEMETWEASRRWLDQIANAGVLFHF\nQSLLSPNLTDEQAMLEDTLVALFDLEKVSFYFKPSEEEPLVANVPLTYQAEGSRQALKVY\nFYIDSYHFEQLPQRLKNGGGFKIHPVLFAQALESMEGYYYRDNVSVEEFQAQINAASLEK\nVKQYNQKLRAFYLDKSNSPPNSTSKAAYVDKLMRPLNALDELYRLVASFIRSKRTAACAN\nTACSASGVGLLSVSSELCNRLGACHIIMCSSGVHRCTLSVTLEQAIILARSHGLPPRYIM\nQATDVMRKQGARVQNTAKNLGVRDRTPQSAPRLYKLCEPPPPAGEE",
"mw": 55.008,
"total_mw": 55.008,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": "Residues 1-467 of P-Rex2"
}
],
"buffer": {
"name": "20 mM HEPES, 200 mM NaCl, 2 mM DTT, 1% glycerol",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.0,
"deuteration": null
},
"purity_method": null,
"name": "Human Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein DH/PH domain and DEP1 module (P-Rex2 DH/PH-DEP1)",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": null,
"full_name": "University of California, Davis",
"webpage": null
}
],
"contributor_name": "Lauren",
"contributor_surname": "Anderson",
"orcid": "http://lauanderson@ucdavis.edu"
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2025-06-10",
"storage_temperature": null,
"cell_temperature": null,
"exposure_time": 2.0,
"number_of_frames": 750,
"wavelength": 0.1127,
"sample_detector_distance": 2.1,
"concentration_min": null,
"concentration_max": 2.0,
"sample_volume": null,
"flow_rate": 0.65,
"s_min": 0.124,
"s_max": 4.707,
"total_exposure_time": null,
"seccolumn": 17
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDZU5_fit1_model1_img.png",
"software": "BILBOMD",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDZU5_fit1_model1.pdb",
"model_mw": 54.21,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": null,
"user": 1310
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDZU5_fit1_fitfoxs_img.png",
"software": "MultiFoXS",
"chi_square_value": 0.549033,
"p_value": 0.1976,
"fit_residual_plot": "SASDZU5_fit1_fitfoxsresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDZU5_fit1.dat",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/feedback_F9oeXGF.log",
"software_version": null,
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": null,
"i0_calibration_standard": null,
"description": "Small-angle X-ray scattering (SAXS) experiments were performed at the SIBYLS beamline 12.3.1 at the Advanced Light Source. This beamline has additional inline instrumentation and detectors coupled to a size exclusion column. Purified P-Rex2 DH/PH-DEP1 was concentrated to 2 mg/ml and then buffer exchanged into 20mM HEPES (pH 7), 200mM NaCl, 2mM DTT, and 1% glycerol SEC running buffer. The X-ray wavelength was set to 1.127 Å and the sample-to-detector distance to 2,100 mm, which gives scattering vectors (q) ranging from 0.01 Å-1 to 0.4 Å-1. The scattering vector is q = 4πsinθ/λ, where 2θ is the scattering angle. The SAXS flow cell was coupled to an Agilent 1260 Infinity HPLC system using a Shodex PROTEIN KW-802.5 SEC column equilibrated with the running buffer with a flow rate of 0.65 ml/min. For SAXS measurements, 2 sec X-ray exposures were collected continuously during a 25 min elution. All frames for analyses had one SAXS frame corresponding to the running buffer before the detection of a peak subtracted from each.",
"experiment_description": null,
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 57.1,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 64.1,
"porod_mw_error": null,
"pddf_i0": 13.5,
"pddf_i0_error": 0.11,
"guinier_i0": 13.2634,
"guinier_i0_error": null,
"pddf_rg": 3.0,
"pddf_rg_error": 0.028,
"guinier_rg": 2.909,
"guinier_rg_error": 0.46,
"pddf_dmax": 10.5,
"pddf_dmax_error": null,
"porod_volume": 77.2,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 21,
"guinier_point_last": 65,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDZU5_datloglog_img.png",
"symmetry": null,
"last_modified": "2026-07-23T20:42:10.776771+02:00",
"bragg_peak": []
}
