The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDZZ9",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/A",
"project": {
"title": "The oligomeric state of chitooligosaccharide deacetylase from the marine bacterium Vibrio campbellii.",
"publication": {
"title": "The oligomeric state of chitooligosaccharide deacetylase from the marine bacterium Vibrio campbellii.",
"author_list": "Pongnan S, Robinson RC, Kamonsutthipaijit N, Fukamizo T, Suginta W",
"journal": "Biophys Rep (N Y)",
"doi": "10.1016/j.bpr.2026.100275",
"pmid": "42341985",
"published_date": "2026 Jun 24"
},
"status": "released",
"submitted_date": "2026-06-16",
"released_date": "2026-06-29"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDZZ9.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDZZ9.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDZZ9_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDZZ9_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDZZ9_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDZZ9_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDZZ9.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "CCD",
"name": "Rayonix SX165",
"resolution": 15.0
},
"name": "Synchrotron Light Research Institute (SLRI)",
"city": "Nakhon Ratchasima",
"country": "Thailand",
"beamline_name": "BL1.3W",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Chito oligosaccharide deacetylase from Vibrio harveyi",
"short_name": "VhCOD",
"sequence": ">|NodB homology domain-containing protein(VhCOD)\r\nQTAPKGTIYLTFDDGPINASIDVINVLNEQGVKGTFYFNAWHLDGIGDENEDRALEALKLALDTGHVVANHSYAHMVHNCVDEFGPTSGAECNATGDHQINAYQDPVYDASTFADNLVVFERYLPNINSYPNYFGEELARLPYTNGWRITKDFKADGLCATSDDLKPWEPGYVCDLDNPSNSVKASIEVQNILANKGYQTHGWDVDWSPENWGIPMPANSLTEAEAFLGYVDAALNSCAPTTINPINSKAHGFPCGTPLHADKVVVLTHEFLYEDGKRGMGATQNLPKLAKFLRIAKEAGYVFDTIDNYTPVWQVGNAYAAGDYVTHSGTVYKAVTAHIAQQDWAPSSTSSLWTNADPATNWTLNVSYEAGDVVTYQGLRYLVNVPHVSQADWTPNTQNTLFTAL",
"organism": "Vibrio campbellii (strain ATCC BAA-1116)",
"uniprot_code": "A7MSF4",
"uniprot_range_first": 23,
"uniprot_range_last": 427,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MKLNKLAMVTLLGTALSQFSFAQTAPKGTIYLTFDDGPINASIDVINVLNEQGVKGTFYF\nNAWHLDGIGDENEDRALEALKLALDTGHVVANHSYAHMVHNCVDEFGPTSGAECNATGDH\nQINAYQDPVYDASTFADNLVVFERYLPNINSYPNYFGEELARLPYTNGWRITKDFKADGL\nCATSDDLKPWEPGYVCDLDNPSNSVKASIEVQNILANKGYQTHGWDVDWSPENWGIPMPA\nNSLTEAEAFLGYVDAALNSCAPTTINPINSKAHGFPCGTPLHADKVVVLTHEFLYEDGKR\nGMGATQNLPKLAKFLRIAKEAGYVFDTIDNYTPVWQVGNAYAAGDYVTHSGTVYKAVTAH\nIAQQDWAPSSTSSLWTNADPATNWTLNVSYEAGDVVTYQGLRYLVNVPHVSQADWTPNTQ\nNTLFTAL",
"mw": 45.0,
"total_mw": 45.0,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": ""
}
],
"buffer": {
"name": "20 mM Tris, 100 mM NaCl",
"concentration_unit": null,
"comment": "20 mM Tris-HCl, pH 7.5, and 100 mM NaCl",
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.5,
"deuteration": null
},
"purity_method": null,
"name": "Chitooligosaccharide deacetylase (NodB) from the marine bacterium Vibrio campbellii (VhCOD) native form",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": null,
"full_name": "Vidyasirimedhi Institute of Science and Technology (VISTEC), Thailand",
"webpage": null
}
],
"contributor_name": "Sirikan",
"contributor_surname": "Pongnan",
"orcid": "https://orcid.org/0009-0004-1378-7065"
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2022-12-14",
"storage_temperature": 4.0,
"cell_temperature": 16.0,
"exposure_time": 600.0,
"number_of_frames": 1,
"wavelength": 0.137,
"sample_detector_distance": 1.7,
"concentration_min": null,
"concentration_max": 4.0,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.213,
"s_max": 3.875,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDZZ9_fit1_model1_img.png",
"software": "PyMOL",
"pdb_link": [
{
"pdb_code": "8yfp",
"ext_code": "8YFP",
"ext_type": "pdb",
"difference_with_model": "identical"
}
],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDZZ9_fit1_model1.pdb",
"model_mw": 44.4,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": null,
"user": 1371
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDZZ9_fit1_fixed_fit_img.png",
"software": "CRYSOL",
"chi_square_value": 34.546,
"p_value": 0.0,
"fit_residual_plot": "SASDZZ9_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDZZ9_fit1.fit",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/Monomer_X-ray_crystal_structure.log",
"software_version": null,
"description": ""
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDZZ9_fit2_model1_img.png",
"software": "DAMMIF",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDZZ9_fit2_model1.cif",
"model_mw": null,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": null,
"user": 1371
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDZZ9_fit2_fixed_fit_img.png",
"software": "DAMMIF",
"chi_square_value": 0.002,
"p_value": 0.0,
"fit_residual_plot": "SASDZZ9_fit2_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDZZ9_fit2.fir",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/VhCOD_4mg_81-damsup.log",
"software_version": null,
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": null,
"experiment_description": null,
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 45.0,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": null,
"porod_mw_error": null,
"pddf_i0": 18.88,
"pddf_i0_error": null,
"guinier_i0": 21.3094,
"guinier_i0_error": null,
"pddf_rg": 2.75,
"pddf_rg_error": null,
"guinier_rg": 3.088,
"guinier_rg_error": 0.018,
"pddf_dmax": 8.1,
"pddf_dmax_error": null,
"porod_volume": null,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 30,
"guinier_point_last": 98,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDZZ9_datloglog_img.png",
"symmetry": null,
"last_modified": "2026-06-29T11:32:40.229497+02:00",
"bragg_peak": []
}
