SAXSdb — 11sz

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

6-deoxyerythronolide-B synthase, Erythronolide synthase EryA2

Amycolatopsis mediterranei

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 6	1B2 Antibody Fragment (Fab) Heavy Chain × 2 1B2 Antibody Fragment (Fab) Light Chain × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	O54666_AMYMD
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 32–995； UniProt 2194–3157 Author chain B； PDBConstruct 32–995； UniProt 2194–3157

6-deoxyerythronolide-B synthase, Erythronolide synthase EryA2

Amycolatopsis mediterranei

UniProt Q03132

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 6	1B2 Antibody Fragment (Fab) Heavy Chain × 2 1B2 Antibody Fragment (Fab) Light Chain × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ERYA2_SACER
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 996–1074； UniProt 3489–3567 Author chain B； PDBConstruct 996–1074； UniProt 3489–3567

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	11sz
Deposition date deposition_date	2026-03-11
Structure title title	Antibody (1B2) Bound Rifamycin Synthetase Module 2
Keywords keywords	polyketide synthase, antibody, BIOSYNTHETIC PROTEIN-Immune System complex; BIOSYNTHETIC PROTEIN/Immune System
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

11sz__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

11sz__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

11sz__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	50.25 Å
Rg (electron density)	50.60 Å
Total Rg	50.62 Å
Atom count	15743
Residues	2115
Excluded volume	277650 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`11sz__assembly_1__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	6-deoxyerythronolide-B synthase, Erythronolide synthase EryA2
Molecular weight formula_weight	115872.8 kDa
EC 编号 ec_number	2.3.1.94
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	15743

MASTDSEKVAEYLRRATLDLRAARQRIRELEEEPIAIVAMACRFPGGVHSPEDLWRLVADGADAVTEFPADRGWDTDRLYHEDPDHEGTTYVRHGAFLDDAAGFDAAFFGISPNEALAMDPQQRLLLETSWELFERAAIDPTTLAGQDIGVFAGVNSHDYSMRMHRAAGVEGFRLTGGSASVLSGRVAYHFGVEGPAVTVDTACSSSLVALHMAVQALQRGECSMALAGGVMVMGTVETFVEFSRQRGLAPDGRCKAFADGADGTGWSEGVGLLLVERLSEAQRRGHQVLAVVRGSAVNSDGASNGLTAPNGPSQQRVIRKALAAAGLSTSDVDAVEAHGTGTTLGDPIEAEALLATYGQNRETPLWLGSVKSNLGHTQAAAGVAGVIKMVMAMRHGVLPRTLHVDRPSSYVDWSAGAVELLTEARDWVSNGHPRRAGVSSFGIGGTNAHVVLEEVAAPITTPQPEPAEFLVPVLVSARTAAGLRGQAGRLAAFLGDRTDVRVPDAAYALATTRAQLDHRAVVLASDRAQLCADLAAFGSGVVTGTPVDGKLAVLFTGQGSQWAGMGRELAETFPVFRDAFEAACEAVDTHLRERPLREVVFDDSALLDQTMYTQGALFAVETALFRLFESWGVRPGLLAGHSIGELAAAHVSGVLDLADAGELVAARGRLMQALPAGGAMVAVQATEDEVAPLLDGTVCVAAVNGPDSVVLSGTEAAVLAVADELAGRGRKTRRLAVSHAFHSPLMEPMLDDFRAVAERLTYRAGSLPVVSTLTGELAALDSPDYWVGQVRNAVRFSDAVTALGAQGASTFLELGPGGALAAMALGTLGGPEQSCVATLRKNGAEVPDVLTALAELHVRGVGVDWTTVLDEPATAVGTVLPTYAFQHQRFWVDVDETAAVSVTPPPAEPIVDRPVQDVLELVRESAAVVLGHRDAGSFDLDRSFKDHGFDSLSAVKLRNRLRDFTGVELPSTLIFDYPNPAVLADHLRAELLGEFAASPAVDIGDRLDELEKALEALSAEDGHDDVGQRLESLLRRWNSRRADAPSTSAISEDASDDELFSMLDQRFGGGEDLGNSSSVDKLAAALEHHHHHH

Source Source

Source organism organism	Amycolatopsis mediterranei
NCBI taxonomy ID ncbi_taxonomy_id	33910
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	1B2 Antibody Fragment (Fab) Heavy Chain
Molecular weight formula_weight	26447.6 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,H

MAEVQLVQSGGGLVQPGRSLRLSCTASGFTFGDYAMSWVRQAPGKGLEWVGFIRSKAYGGTTEYAASVKGRFTISRDDSKSIAYLQMNSLKTEDTAVYYCTRGGTLFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCAALVPRGSAHHHHHHAADYKDDDDKA

Source Source

Source organism organism	Homo sapiens
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 polymer

Description description	1B2 Antibody Fragment (Fab) Light Chain
Molecular weight formula_weight	25715.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,L

LFAIPLVVPFYSHSALDVVMTQSPLSLPVTPGEPASISCRSSQSLLHSNGYNYLDWYLQKPGQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQSLQTPRLTFGPGTKVDIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPRGAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Source Source

Source organism organism	Homo sapiens
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli BL21(DE3)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.940 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Resolution resolution	2.94 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	852885

Antibody (1B2) Bound Rifamycin Synthetase Module 2

1. Protein Identity and Related Structures Protein Identity & Related Structures

6-deoxyerythronolide-B synthase, Erythronolide synthase EryA2

State in the Current Structure

Other States of the Same Protein in the Database

6-deoxyerythronolide-B synthase, Erythronolide synthase EryA2

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

11sz__assembly_1__model_1

11sz__assembly_1__model_1 | I(q)

11sz__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

7. Citations (1)

Antibody (1B2) Bound Rifamycin Synthetase Module 2

1. Protein Identity and Related Structures Protein Identity & Related Structures

6-deoxyerythronolide-B synthase, Erythronolide synthase EryA2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

6-deoxyerythronolide-B synthase, Erythronolide synthase EryA2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

11sz__assembly_1__model_1

11sz__assembly_1__model_1 | I(q)

11sz__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

7. Citations (1)