← Back to search

13ft

START domain of Caenorhabditis elegans StAR-related lipid transfer protein 3 (STARD3)

Method: X-RAY DIFFRACTION D_max: 84.8 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	13ft
deposition_date	2026-05-04
last_revision	2026-05-13
title	START domain of Caenorhabditis elegans StAR-related lipid transfer protein 3 (STARD3)
keywords	cholesterol, cholesterol traffic, cholesterol metabolism, physical biochemistry, STARD3, START domain, NPC1/NPC2, LIPID TRANSPORT; LIPID TRANSPORT
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	25.20 Å
rg_electron	24.27 Å
i0	39884500.00
molecular_weight	49117.0 kDa
excluded_volume	61675 Å³
envelope_volume	75573 Å³
shell_volume	26137 Å³
envelope_diameter	86.8 Å
shell_rg	31.17 Å
envelope_rg	24.68 Å
shape_rg	24.23 Å
total_rg	25.20 Å
total_atoms	3453
n_residues	417
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	84.8 Å
rg_real	25.23 Å
rg_real_error	0.69 Å
i0_real	3.9880e+07
i0_real_error	5.5450e+05
rg_reciprocal	25.22 Å
i0_reciprocal	39880000.0000
total_estimate	0.8758
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	28.2 Å
skewness	0.408
kurtosis	-0.305
angular_range	— – 0.3150 Å⁻¹
current_alpha	0.0000
highest_alpha	9769000.0000
n_real_points	64
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.817; Stabil: 0.999; Sysdev: 1.000; Positv: 1.000; Valcen: 0.941; Smooth: 0.993

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (5)

Entity 1 polymer

description	START domain-containing protein
formula_weight	26256.0 kDa
src_method	man
entity_count	2

Polymer

type	polypeptide(L)
strand_id	A,B
atom_count	3689

GAEFSSDEEARSRLLVPPDTKRLFEITLRECLDQVEELMRDSRLGGWKTLRSANPTVLQGPDNYFLVRSEFNKFPALVLFNIAWKDMLKWNTQVIEGKMIAHLDNATDLYYSVSAPAMRGYISSRDFLDLRKIKLDSSADVYTGYFVSVESNLCPNNGNPKIVRGHNFPSMIRTLKDEAGVTYFEWLMKTDLKGGLPRRLVHSGMVNYFSEHVKRMNEFAETHYHCPP

Source

organism	Caenorhabditis elegans
ncbi_taxonomy_id	6239
host_organism	Escherichia coli BL21(DE3)

Entity 2 non-polymer

description	TETRAETHYLENE GLYCOL
formula_weight	194.2 kDa
src_method	syn
entity_count	2

Entity 3 non-polymer

description	GLYCEROL
formula_weight	92.1 kDa
src_method	syn
entity_count	3

Entity 4 non-polymer

description	SULFATE ION
formula_weight	96.1 kDa
src_method	syn
entity_count	2

Entity 5 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	236

▶

6. Citations (1)

▶

length_a	44.774 Å
length_b	79.249 Å
length_c	72.512 Å
angle_alpha	90.00 °
angle_beta	90.27 °
angle_gamma	90.00 °
z_pdb	4

space_group	P 1 21 1
int_tables_number	4
crystal_system	monoclinic

resolution	2.010 Å
resolution_low	29.670 Å
r_factor	0.1821
r_work	0.1804
r_free	0.2135

fit	/app/data/saxs_computation/3f/13ft/13ft.fit
pddf	/app/data/pr_computation/3f/13ft/13ft.pr.out
profile	/app/data/saxs_computation/3f/13ft/13ft.dat