← Back to search

13nu

PanDDA analysis group deposition -- Crystal structure of PLpro-C111S in complex with Fr13806

Method: X-RAY DIFFRACTION D_max: 85.4 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	13nu
deposition_date	2025-09-17
last_revision	2026-02-18
title	PanDDA analysis group deposition -- Crystal structure of PLpro-C111S in complex with Fr13806
keywords	PLpro, SARS-CoV-2, HYDROLASE; HYDROLASE
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	23.71 Å
rg_electron	23.20 Å
i0	41113900.00
molecular_weight	33312.0 kDa
excluded_volume	32235 Å³
envelope_volume	53628 Å³
shell_volume	20826 Å³
envelope_diameter	89.6 Å
shell_rg	28.47 Å
envelope_rg	23.62 Å
shape_rg	23.12 Å
total_rg	23.82 Å
total_atoms	2510
n_residues	313
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	85.4 Å
rg_real	23.92 Å
rg_real_error	0.84 Å
i0_real	4.1110e+07
i0_real_error	5.6950e+05
rg_reciprocal	23.87 Å
i0_reciprocal	41110000.0000
total_estimate	0.8252
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	24.0 Å
skewness	0.582
kurtosis	-0.041
angular_range	— – 0.3350 Å⁻¹
current_alpha	0.0000
highest_alpha	6101000.0000
n_real_points	65
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.682; Stabil: 0.999; Sysdev: 1.000; Positv: 1.000; Valcen: 0.689; Smooth: 0.990

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (5)

Entity 1 polymer

description	Papain-like protease nsp3
formula_weight	39803.1 kDa
ec_number	3.4.19.12,3.4.22.-
mutation	C111S
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	A
atom_count	2729

MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSSLREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNSYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKHV

Source

organism	Severe acute respiratory syndrome coronavirus 2
ncbi_taxonomy_id	2697049
host_organism	Escherichia coli BL21(DE3)

Entity 2 non-polymer

description	ZINC ION
formula_weight	65.4 kDa
src_method	syn
entity_count	1

Entity 3 non-polymer

description	MALONATE ION
formula_weight	102.0 kDa
src_method	syn
entity_count	2

Entity 4 non-polymer

description	1,1'-(piperidine-1,4-diyl)di(ethan-1-one)
formula_weight	169.2 kDa
src_method	syn
entity_count	1

Entity 5 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	219

▶

6. Citations (1)

▶

length_a	81.860 Å
length_b	81.860 Å
length_c	135.020 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	120.00 °
z_pdb	6

space_group	P 32 2 1
int_tables_number	154
crystal_system	trigonal

resolution	1.970 Å
resolution_low	38.000 Å
r_factor	0.1645
r_work	0.1633
r_free	0.1884

fit	/app/data/saxs_computation/3n/13nu/13nu.fit
pddf	/app/data/pr_computation/3n/13nu/13nu.pr.out
profile	/app/data/saxs_computation/3n/13nu/13nu.dat