← Back to search

13nw

PanDDA analysis group deposition -- Crystal structure of PLpro-C111S in complex with Fr13256

Method: X-RAY DIFFRACTION D_max: 85.6 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	13nw
deposition_date	2025-09-17
last_revision	2026-02-18
title	PanDDA analysis group deposition -- Crystal structure of PLpro-C111S in complex with Fr13256
keywords	PLpro, SARS-CoV-2, HYDROLASE; HYDROLASE
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	23.77 Å
rg_electron	23.24 Å
i0	41048400.00
molecular_weight	33355.0 kDa
excluded_volume	32337 Å³
envelope_volume	54055 Å³
shell_volume	20954 Å³
envelope_diameter	90.1 Å
shell_rg	28.49 Å
envelope_rg	23.63 Å
shape_rg	23.16 Å
total_rg	23.87 Å
total_atoms	2516
n_residues	313
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	85.6 Å
rg_real	23.98 Å
rg_real_error	0.81 Å
i0_real	4.1050e+07
i0_real_error	6.1710e+05
rg_reciprocal	23.93 Å
i0_reciprocal	41050000.0000
total_estimate	0.8253
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	24.1 Å
skewness	0.582
kurtosis	-0.035
angular_range	— – 0.3350 Å⁻¹
current_alpha	0.0000
highest_alpha	6240000.0000
n_real_points	65
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.683; Stabil: 0.999; Sysdev: 1.000; Positv: 1.000; Valcen: 0.694; Smooth: 0.985

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (4)

Entity 1 polymer

description	Papain-like protease nsp3
formula_weight	39803.1 kDa
ec_number	3.4.19.12,3.4.22.-
mutation	C111S
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	A
atom_count	2591

MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSSLREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNSYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKHV

Source

organism	Severe acute respiratory syndrome coronavirus 2
ncbi_taxonomy_id	2697049
host_organism	Escherichia coli BL21(DE3)

Entity 2 non-polymer

description	ZINC ION
formula_weight	65.4 kDa
src_method	syn
entity_count	1

Entity 3 non-polymer

description	4-(4-methyl-1,4-diazepan-1-yl)benzonitrile
formula_weight	215.3 kDa
src_method	syn
entity_count	2

Entity 4 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	75

▶

6. Citations (1)

▶

length_a	83.060 Å
length_b	83.060 Å
length_c	133.960 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	120.00 °
z_pdb	6

space_group	P 32 2 1
int_tables_number	154
crystal_system	trigonal

resolution	2.370 Å
resolution_low	37.940 Å
r_factor	0.1855
r_work	0.1840
r_free	0.2150

fit	/app/data/saxs_computation/3n/13nw/13nw.fit
pddf	/app/data/pr_computation/3n/13nw/13nw.pr.out
profile	/app/data/saxs_computation/3n/13nw/13nw.dat

PanDDA analysis group deposition -- Crystal structure of PLpro-C111S in complex with Fr13256

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction