SAXSdb — 1all

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

ALLOPHYCOCYANIN

OrganismNot specified

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 1–160	Not recorded	ALLOPHYCOCYANIN × 1 （P72505） CYC PHYCOCYANOBILIN × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed experimental conditions	Resolution 2.30 Å
2	Protein heterocomplex Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain A； UniProt 1–160	Not recorded	ALLOPHYCOCYANIN × 3 （P72505） CYC PHYCOCYANOBILIN × 6	X-RAY DIFFRACTION mmCIF provides none of the parsed experimental conditions	Resolution 2.30 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	PHAA_SPIPL
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–160； UniProt 1–160

ALLOPHYCOCYANIN

OrganismNot specified

UniProt P72505

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain B； UniProt 1–161	Non-standard monomer：Yes (specific site not provided by mmCIF)	ALLOPHYCOCYANIN × 1 （P72504） CYC PHYCOCYANOBILIN × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed experimental conditions	Resolution 2.30 Å
2	Protein heterocomplex Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain B； UniProt 1–161	Non-standard monomer：Yes (specific site not provided by mmCIF)	ALLOPHYCOCYANIN × 3 （P72504） CYC PHYCOCYANOBILIN × 6	X-RAY DIFFRACTION mmCIF provides none of the parsed experimental conditions	Resolution 2.30 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	PHAB_SPIPL
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–161； UniProt 1–161

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1all
Deposition date deposition_date	1995-03-01
Structure title title	ALLOPHYCOCYANIN
Keywords keywords	LIGHT-HARVESTING PROTEIN, PHYCOBILIPROTEIN; LIGHT-HARVESTING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	25.39 Å
Radius of gyration Rg (electron density) rg_electron	24.97 Å
Forward intensity I(0) i0	21143700.00
Molecular weight molecular_weight	35524.0 kDa
Excluded volume excluded_volume	44656 Å³
Envelope volume envelope_volume	52913 Å³
Hydration-shell volume shell_volume	19259 Å³
Envelope diameter envelope_diameter	92.2 Å
Shell Rg shell_rg	29.68 Å
Envelope Rg envelope_rg	25.23 Å
Shape Rg shape_rg	24.97 Å
Total Rg total_rg	25.54 Å
Total atoms total_atoms	2494
Residues n_residues	320
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	90.2 Å
Rg (real space) rg_real	25.64 Å
Rg uncertainty (real space) rg_real_error	0.79 Å
I(0) (real space) i0_real	2.1140e+07
I(0) uncertainty (real space) i0_real_error	3.0820e+05
Rg (reciprocal space) rg_reciprocal	25.57 Å
I(0) (reciprocal space) i0_reciprocal	21140000.0000
Solution quality estimate total_estimate	0.6063
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	21.5 Å
Skewness Skewness skewness	0.557
Kurtosis Kurtosis kurtosis	-0.347
Angular range angular_range	— – 0.3150 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	6433000.0000
Real-space data points n_real_points	64
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.593; Stabil: 1.000; Sysdev: 0.242; Positv: 1.000; Valcen: 0.422; Smooth: 0.948

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	ALLOPHYCOCYANIN
Molecular weight formula_weight	17107.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	2586

SIVTKSIVNADAEARYLSPGELDRIKSFVTSGERRVRIAETMTGARERIIKQAGDQLFGKRPDVVSPGGNAYGADMTATCLRDLDYYLRLITYGIVAGDVTPIEEIGVVGVREMYKSLGTPIEAIAEGVRAMKSVATSLLSGADAAEAGSYFDYLIGAMS

Entity 2 Entity 2 polymer

Description description	ALLOPHYCOCYANIN
Molecular weight formula_weight	17273.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MQDAITSVINSSDVQGKYLDASAIQKLKAYFATGELRVRAATTISANAANIVKEAVAKSLLYSDVTRPGGNMYTTRRYAACIRDLDYYLRYATYAMLAGDPSILDERVLNGLKETYNSLGVPIGATVQAIQAMKEVTAGLVGGGAGKEMGIYFDYICSGLS

Entity 3 Entity 3 non-polymer

Description description	PHYCOCYANOBILIN
Molecular weight formula_weight	588.7 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	92

▼

7. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d1alla_
Class class	a — All alpha proteins
Fold Fold fold	a.1 — Globin-like
Superfamily Superfamily superfamily	a.1.1 — Globin-like
Family Family family	a.1.1.3 — Phycocyanin-like phycobilisome proteins

Domain ID domain_id	d1allb_
Class class	a — All alpha proteins
Fold Fold fold	a.1 — Globin-like
Superfamily Superfamily superfamily	a.1.1 — Globin-like
Family Family family	a.1.1.3 — Phycocyanin-like phycobilisome proteins

CATH v4.4 (2 domains)

Domain ID domain_id	1allA00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	490 — Globin-like
Homologous superfamily homologous superfamily	20 — Phycocyanins

Domain ID domain_id	1allB00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	490 — Globin-like
Homologous superfamily homologous superfamily	20 — Phycocyanins

▶

8. Citations (1)

▶

Unit-cell length a length_a	101.900 Å
Unit-cell length b length_b	101.900 Å
Unit-cell length c length_c	130.600 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 63 2 2
Space-group number int_tables_number	182
Crystal system crystal_system	—

Resolution resolution	2.300 Å
Low-resolution limit resolution_low	8.000 Å
R factor r_factor	0.1960
R_work r_work	0.1960
R_free r_free	—

fit	/app/data/saxs_computation/al/1all/1all.fit
pddf	/app/data/pr_computation/al/1all/1all.pr.out
profile	/app/data/saxs_computation/al/1all/1all.dat

ALLOPHYCOCYANIN

1. Protein Identity and Related Structures Protein Identity & Related Structures

ALLOPHYCOCYANIN

State in the Current Structure

Other States of the Same Protein in the Database

ALLOPHYCOCYANIN

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

CATH v4.4 (2 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)