SAXSdb — 1cr4

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA PRIMASE/HELICASE

Enterobacteria phage T7

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein homooligomer Homooligomer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain A； UniProt 271–566	Fragment：HELICASE DOMAIN	SO4 SULFATE ION × 12 TYD THYMIDINE-5'-DIPHOSPHATE × 6	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 9；298 K；AMMONIUM SULFATE, ACES, pH 9.00, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.50 Å R-free 0.287

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 1CR4	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1CR0 CRYSTAL STRUCTURE OF THE HELICASE DOMAIN OF THE GENE4 PROTEIN OF BACTERIOPHAGE T7 Deposited 1999-08-12	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 271–566（296 aa） Fragment：HELICASE DOMAIN	Not recorded	SO4 SULFATE ION × 12	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 9；298 K；AMMONIUM SULFATE, ACES, pH 9.00, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.30 Å R-free 0.298
1CR1 CRYSTAL STRUCTURE OF THE HELICASE DOMAIN OF THE GENE 4 PROTEIN OF BACTERIOPHAGE T7: COMPLEX WITH DTTP Deposited 1999-08-12	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 271–566（296 aa） Fragment：HELICASE DOMAIN	Not recorded	SO4 SULFATE ION × 12 TTP THYMIDINE-5'-TRIPHOSPHATE × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 9；298 K；AMMONIUM SULFATE, ACES, pH 9, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.30 Å R-free 0.288
1CR2 CRYSTAL STRUCTURE OF THE HELICASE DOMAIN OF THE GENE 4 PROTEIN OF BACTERIOPHAGE T7: COMPLEX WITH DATP Deposited 1999-08-12	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 271–566（296 aa） Fragment：HELICASE DOMAIN	Not recorded	SO4 SULFATE ION × 12 DTP 2'-DEOXYADENOSINE 5'-TRIPHOSPHATE × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 9；298 K；ammonium sulfate, ACES, pH 9.00, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.30 Å R-free 0.296
1E0J gp4d helicase from phage T7 ADPNP complex Deposited 2000-03-30	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 261–549（289 aa） Fragment：DOMAIN 4D Chain B 261–549（289 aa） Fragment：DOMAIN 4D Chain C 261–549（289 aa） Fragment：DOMAIN 4D	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 4 MG MAGNESIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions pH 9.5；pH 9.50	Resolution 3.00 Å R-free 0.304
1E0J gp4d helicase from phage T7 ADPNP complex Deposited 2000-03-30	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain D 261–549（289 aa） Fragment：DOMAIN 4D Chain E 261–549（289 aa） Fragment：DOMAIN 4D Chain F 261–549（289 aa） Fragment：DOMAIN 4D	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 4 MG MAGNESIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions pH 9.5；pH 9.50	Resolution 3.00 Å R-free 0.304
1E0K gp4d helicase from phage T7 Deposited 2000-03-30	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 261–549（289 aa） Fragment：DOMAIN 4D Chain B 261–549（289 aa） Fragment：DOMAIN 4D Chain C 261–549（289 aa） Fragment：DOMAIN 4D	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 9.5；pH 9.50	Resolution 3.30 Å R-free 0.308
1E0K gp4d helicase from phage T7 Deposited 2000-03-30	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain D 261–549（289 aa） Fragment：DOMAIN 4D Chain E 261–549（289 aa） Fragment：DOMAIN 4D Chain F 261–549（289 aa） Fragment：DOMAIN 4D	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 9.5；pH 9.50	Resolution 3.30 Å R-free 0.308
1NUI Crystal Structure of the primase fragment of Bacteriophage T7 primase-helicase protein Deposited 2003-01-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–255（255 aa） Fragment：residues 1-255	Mutation：M64G	ZN ZINC ION × 1 MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.3；295 K；Sodium Formate, MES, DTT, ATP, pH 6.3, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.90 Å R-free 0.277
1NUI Crystal Structure of the primase fragment of Bacteriophage T7 primase-helicase protein Deposited 2003-01-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–255（255 aa） Fragment：residues 1-255	Mutation：M64G	ZN ZINC ION × 1 MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.3；295 K；Sodium Formate, MES, DTT, ATP, pH 6.3, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.90 Å R-free 0.277
1Q57 The Crystal Structure of the Bifunctional Primase-Helicase of Bacteriophage T7 Deposited 2003-08-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 7 PDB declaration: heptameric	Chain A 64–566（503 aa） Chain B 64–566（503 aa） Chain C 64–566（503 aa） Chain D 64–566（503 aa） Chain E 64–566（503 aa） Chain F 64–566（503 aa） Chain G 64–566（503 aa）	Mutation：G317V, K318M Mutation：G317V, K318M Mutation：G317V, K318M Mutation：G317V, K318M Mutation：G317V, K318M Mutation：G317V, K318M Mutation：G317V, K318M	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.2；277 K；MES, sodium citrate, pH 7.2, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 3.45 Å R-free 0.326
5IKN Crystal Structure of the T7 Replisome in the Absence of DNA Deposited 2016-03-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 13 PDB declaration: tridecameric	Chain D 64–549（486 aa） Chain E 64–549（486 aa） Chain F 64–549（486 aa） Chain G 64–549（486 aa） Chain H 64–549（486 aa） Chain I 64–549（486 aa） Chain J 64–549（486 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；295.15 K；1.47-1.62M Sodium Formate 0.1M Tris pH 7.5	Resolution 4.80 Å R-free 0.318
6N7I Structure of bacteriophage T7 E343Q mutant gp4 helicase-primase in complex with ssDNA, dTTP, AC dinucleotide and CTP (gp4(5)-DNA) Deposited 2018-11-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 6 PDB declaration: heptameric	Chain A 1–566（566 aa） Chain B 1–566（566 aa） Chain C 1–566（566 aa） Chain D 1–566（566 aa） Chain E 1–566（566 aa） Chain F 1–566（566 aa）	Mutation：E343Q Mutation：E343Q Mutation：E343Q Mutation：E343Q Mutation：E343Q Mutation：E343Q	TTP THYMIDINE-5'-TRIPHOSPHATE × 4 MG MAGNESIUM ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6N7N Structure of bacteriophage T7 E343Q mutant gp4 helicase-primase in complex with ssDNA, dTTP, AC dinucleotide and CTP (form I) Deposited 2018-11-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 6 PDB declaration: heptameric	Chain A 1–566（566 aa） Chain B 1–566（566 aa） Chain C 1–566（566 aa） Chain D 1–566（566 aa） Chain E 1–566（566 aa） Chain F 1–566（566 aa）	Mutation：E343Q Mutation：E343Q Mutation：E343Q Mutation：E343Q Mutation：E343Q Mutation：E343Q	TTP THYMIDINE-5'-TRIPHOSPHATE × 5 MG MAGNESIUM ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
6N7S Structure of bacteriophage T7 E343Q mutant gp4 helicase-primase in complex with ssDNA, dTTP, AC dinucleotide and CTP (form II) Deposited 2018-11-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 6 PDB declaration: heptameric	Chain A 1–566（566 aa） Chain B 1–566（566 aa） Chain C 1–566（566 aa） Chain D 1–566（566 aa） Chain E 1–566（566 aa） Chain F 1–566（566 aa）	Mutation：E343Q Mutation：E343Q Mutation：E343Q Mutation：E343Q Mutation：E343Q Mutation：E343Q	TTP THYMIDINE-5'-TRIPHOSPHATE × 4 MG MAGNESIUM ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.60 Å
6N7T Structure of bacteriophage T7 E343Q mutant gp4 helicase-primase in complex with ssDNA, dTTP, AC dinucleotide and CTP (form III) Deposited 2018-11-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 6 PDB declaration: heptameric	Chain A 1–566（566 aa） Chain B 1–566（566 aa） Chain C 1–566（566 aa） Chain D 1–566（566 aa） Chain E 1–566（566 aa） Chain F 1–566（566 aa）	Mutation：E343Q Mutation：E343Q Mutation：E343Q Mutation：E343Q Mutation：E343Q Mutation：E343Q	TTP THYMIDINE-5'-TRIPHOSPHATE × 5 MG MAGNESIUM ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
6N7V Structure of bacteriophage T7 gp4 (helicase-primase, E343Q mutant) in complex with ssDNA, dTTP, AC dinucleotide, and CTP (from multiple lead complexes) Deposited 2018-11-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 6 PDB declaration: heptameric	Chain A 1–566（566 aa） Chain B 1–566（566 aa） Chain C 1–566（566 aa） Chain D 1–566（566 aa） Chain E 1–566（566 aa） Chain F 1–566（566 aa）	Mutation：E343Q Mutation：E343Q Mutation：E343Q Mutation：E343Q Mutation：E343Q Mutation：E343Q	TTP THYMIDINE-5'-TRIPHOSPHATE × 5 MG MAGNESIUM ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
6N9U Structure of bacteriophage T7 lagging-strand DNA polymerase (D5A/E7A) interacting with primase domains of two gp4 subunits bound to an RNA/DNA hybrid and dTTP (from LagS1) Deposited 2018-12-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: pentameric	Chain E 1–566（566 aa） Chain F 1–566（566 aa）	Mutation：E343Q Mutation：E343Q	ZN ZINC ION × 1 TTP THYMIDINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
6N9V Structure of bacteriophage T7 lagging-strand DNA polymerase (D5A/E7A) and gp4 (helicase/primase) bound to DNA including RNA/DNA hybrid, and an incoming dTTP (LagS1) Deposited 2018-12-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 7 PDB declaration: nonameric	Chain A 1–566（566 aa） Chain B 1–566（566 aa） Chain C 1–566（566 aa） Chain D 1–566（566 aa） Chain E 1–566（566 aa） Chain F 1–566（566 aa）	Mutation：E343Q Mutation：E343Q Mutation：E343Q Mutation：E343Q Mutation：E343Q Mutation：E343Q	TTP THYMIDINE-5'-TRIPHOSPHATE × 6 MG MAGNESIUM ION × 7 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å
6N9W Structure of bacteriophage T7 lagging-strand DNA polymerase (D5A/E7A) and gp4 (helicase/primase) bound to DNA including RNA/DNA hybrid, and an incoming dTTP (LagS2) Deposited 2018-12-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 7 PDB declaration: nonameric	Chain A 1–566（566 aa） Chain B 1–566（566 aa） Chain C 1–566（566 aa） Chain D 1–566（566 aa） Chain E 1–566（566 aa） Chain F 1–566（566 aa）	Mutation：E343Q Mutation：E343Q Mutation：E343Q Mutation：E343Q Mutation：E343Q Mutation：E343Q	ZN ZINC ION × 1 TTP THYMIDINE-5'-TRIPHOSPHATE × 5 MG MAGNESIUM ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å
6N9X Structure of bacteriophage T7 lagging-strand DNA polymerase (D5A/E7A) and gp4 (helicase/primase) bound to DNA including RNA/DNA hybrid, and an incoming dTTP (LagS3) Deposited 2018-12-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 7 PDB declaration: nonameric	Chain A 1–566（566 aa） Chain B 1–566（566 aa） Chain C 1–566（566 aa） Chain D 1–566（566 aa） Chain E 1–566（566 aa） Chain F 1–566（566 aa）	Mutation：E343Q Mutation：E343Q Mutation：E343Q Mutation：E343Q Mutation：E343Q Mutation：E343Q	ZN ZINC ION × 1 TTP THYMIDINE-5'-TRIPHOSPHATE × 5 MG MAGNESIUM ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å

17 other PDB entries and 20 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	PRIM_BPT7
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–296； UniProt 271–566

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1cr4
Deposition date deposition_date	1999-08-12
Structure title title	CRYSTAL STRUCTURE OF THE HELICASE DOMAIN OF THE GENE 4 PROTEIN OF BACTERIOPHAGE T7: COMPLEX WITH DTDP
Keywords keywords	RECA-TYPE PROTEIN FOLD, TRANSFERASE; TRANSFERASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	19.77 Å
Radius of gyration Rg (electron density) rg_electron	18.61 Å
Forward intensity I(0) i0	13393300.00
Molecular weight molecular_weight	26832.0 kDa
Excluded volume excluded_volume	33374 Å³
Envelope volume envelope_volume	40089 Å³
Hydration-shell volume shell_volume	18428 Å³
Envelope diameter envelope_diameter	76.0 Å
Shell Rg shell_rg	24.72 Å
Envelope Rg envelope_rg	19.34 Å
Shape Rg shape_rg	18.61 Å
Total Rg total_rg	19.52 Å
Total atoms total_atoms	1875
Residues n_residues	243
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	74.1 Å
Rg (real space) rg_real	19.78 Å
Rg uncertainty (real space) rg_real_error	0.56 Å
I(0) (real space) i0_real	1.3390e+07
I(0) uncertainty (real space) i0_real_error	1.7680e+05
Rg (reciprocal space) rg_reciprocal	19.78 Å
I(0) (reciprocal space) i0_reciprocal	13390000.0000
Solution quality estimate total_estimate	0.7330
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	24.0 Å
Skewness Skewness skewness	0.458
Kurtosis Kurtosis kurtosis	0.222
Angular range angular_range	— – 0.4000 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	2100000.0000
Real-space data points n_real_points	72
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.546; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.888; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	DNA PRIMASE/HELICASE
Molecular weight formula_weight	32832.0 kDa
EC 编号 ec_number	2.7.7.-
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	1890

MRERIREHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGFAKSTGVVLVVICHLKNPDKGKAHEEGRPVSITDLRGSGALRQLSDTIIALERNQQGDMPNLVLVRILKCRFTGDTGIAGYMEYNKETGWLEPSSYSGEEESHSESTDWSNDTDF

来源 Source

来源生物 organism	Enterobacteria phage T7
NCBI Class编号 ncbi_taxonomy_id	10760
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 3 Entity 3 non-polymer

Description description	THYMIDINE-5'-DIPHOSPHATE
Molecular weight formula_weight	402.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	15

▼

7. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (1 domains)

Domain ID domain_id	d1cr4a_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.37 — P-loop containing nucleoside triphosphate hydrolases
Superfamily Superfamily superfamily	c.37.1 — P-loop containing nucleoside triphosphate hydrolases
Family Family family	c.37.1.11 — RecA protein-like (ATPase-domain)

CATH v4.4 (1 domains)

Domain ID domain_id	1cr4A00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

▶

8. Citations (1)

▶

Unit-cell length a length_a	80.784 Å
Unit-cell length b length_b	80.784 Å
Unit-cell length c length_c	85.852 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	6

Space group space_group	P 61
Space-group number int_tables_number	169
Crystal system crystal_system	—

Resolution resolution	2.500 Å
Low-resolution limit resolution_low	20.000 Å
R factor r_factor	0.2510
R_work r_work	0.2420
R_free r_free	0.2870

fit	/app/data/saxs_computation/cr/1cr4/1cr4.fit
pddf	/app/data/pr_computation/cr/1cr4/1cr4.pr.out
profile	/app/data/saxs_computation/cr/1cr4/1cr4.dat

CRYSTAL STRUCTURE OF THE HELICASE DOMAIN OF THE GENE 4 PROTEIN OF BACTERIOPHAGE T7: COMPLEX WITH DTDP

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA PRIMASE/HELICASE

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction