SAXSdb — 1eyx

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

R-PHYCOERYTHRIN

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	R-PHYCOERYTHRIN × 2 （Q7SIF9） R-PHYCOERYTHRIN × 2 SULFATE ION × 2 PHYCOCYANOBILIN × 8 PHYCOUROBILIN × 2 water × 5	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 18	R-PHYCOERYTHRIN × 6 （Q7SIF9） R-PHYCOERYTHRIN × 6 SULFATE ION × 6 PHYCOCYANOBILIN × 24 PHYCOUROBILIN × 6 water × 15	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q7SIG0_GRACH
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–164； UniProt 1–164 Author chain K； PDBConstruct 1–164； UniProt 1–164

R-PHYCOERYTHRIN

OrganismNot specified

UniProt Q7SIF9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	R-PHYCOERYTHRIN × 2 （Q7SIG0） R-PHYCOERYTHRIN × 2 SULFATE ION × 2 PHYCOCYANOBILIN × 8 PHYCOUROBILIN × 2 water × 5	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 18	R-PHYCOERYTHRIN × 6 （Q7SIG0） R-PHYCOERYTHRIN × 6 SULFATE ION × 6 PHYCOCYANOBILIN × 24 PHYCOUROBILIN × 6 water × 15	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q7SIF9_GRACH
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–177； UniProt 1–177 Author chain L； PDBConstruct 1–177； UniProt 1–177

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1eyx
Deposition date deposition_date	2000-05-09
Structure title title	CRYSTAL STRUCTURE OF R-PHYCOERYTHRIN AT 2.2 ANGSTROMS
Keywords keywords	R-PHYCOERYTHRIN, MACROSEEDING, TWIN, PROTEIN STRUCTURE, SEQUENCES, PHYCOBILIPROTEIN, RED ALGAE, PHOTOSYNTHESIS; PHOTOSYNTHESIS
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1eyx__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1eyx__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1eyx__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	29.25 Å
Rg (electron density)	28.47 Å
Total Rg	29.13 Å
Atom count	5609
Residues	691
Excluded volume	99696 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1eyx__assembly_1__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`1eyx__assembly_2__model_1`	octadecameric （18）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	R-PHYCOERYTHRIN
Molecular weight formula_weight	17770.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,K
Atom count atom_count	5719

MKSVITTVISAADSAGRFPSSSDLESVQGNIQRASARLEAAEKLASNHEAVVKEAGDACFGKYGYLKNPGEAGENQEKINKCYRDIDHYMRLVNYSLVIGGTGPLDEWGIAGAREVYRTLNLPTSAYIAAFAFTRDRLCGPRDMSAQAGVEYSTALDYIINSLS

Entity 2 Entity 2 polymer

Description description	R-PHYCOERYTHRIN
Molecular weight formula_weight	18634.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,L

MLDAFSRVISNADAKAAYVGGSDLQALRTFISDGNKRLDAVNYIVSNSSCIVSDAISGMICENPGLITPGGNCYTNRRMAACLRDGEIILRYISYALLAGDSSVLEDRCLNGLKETYIALGVPTNSTVRAVSIMKAAVGAFISNTASQRKGEVIEGDCSALAAEIASYCDRISAAVS

Entity 3 Entity 3 polymer

Description description	R-PHYCOERYTHRIN
Molecular weight formula_weight	606.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,H

AAFRAA

Entity 4 Entity 4 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 5 Entity 5 non-polymer

Description description	PHYCOCYANOBILIN
Molecular weight formula_weight	588.7 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 6 Entity 6 non-polymer

Description description	PHYCOUROBILIN
Molecular weight formula_weight	590.7 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 7 Entity 7 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	110

▼

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d1eyxa_
Class class	a — All alpha proteins
Fold Fold fold	a.1 — Globin-like
Superfamily Superfamily superfamily	a.1.1 — Globin-like
Family Family family	a.1.1.3 — Phycocyanin-like phycobilisome proteins

Domain ID domain_id	d1eyxb_
Class class	a — All alpha proteins
Fold Fold fold	a.1 — Globin-like
Superfamily Superfamily superfamily	a.1.1 — Globin-like
Family Family family	a.1.1.3 — Phycocyanin-like phycobilisome proteins

Domain ID domain_id	d1eyxk_
Class class	a — All alpha proteins
Fold Fold fold	a.1 — Globin-like
Superfamily Superfamily superfamily	a.1.1 — Globin-like
Family Family family	a.1.1.3 — Phycocyanin-like phycobilisome proteins

Domain ID domain_id	d1eyxl_
Class class	a — All alpha proteins
Fold Fold fold	a.1 — Globin-like
Superfamily Superfamily superfamily	a.1.1 — Globin-like
Family Family family	a.1.1.3 — Phycocyanin-like phycobilisome proteins

CATH v4.4 (4 domains)

Domain ID domain_id	1eyxA00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	490 — Globin-like
Homologous superfamily homologous superfamily	20 — Phycocyanins

Domain ID domain_id	1eyxB00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	490 — Globin-like
Homologous superfamily homologous superfamily	20 — Phycocyanins

Domain ID domain_id	1eyxK00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	490 — Globin-like
Homologous superfamily homologous superfamily	20 — Phycocyanins

Domain ID domain_id	1eyxL00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	490 — Globin-like
Homologous superfamily homologous superfamily	20 — Phycocyanins

▶

Unit-cell length a length_a	187.268 Å
Unit-cell length b length_b	187.268 Å
Unit-cell length c length_c	59.109 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	18

Space group space_group	H 3
Space-group number int_tables_number	146
Crystal system crystal_system	—

Resolution resolution	2.250 Å
Low-resolution limit resolution_low	999.000 Å
R factor r_factor	0.1920
R_work r_work	—
R_free r_free	0.2790

CRYSTAL STRUCTURE OF R-PHYCOERYTHRIN AT 2.2 ANGSTROMS

1. Protein Identity and Related Structures Protein Identity & Related Structures

R-PHYCOERYTHRIN

State in the Current Structure

Other States of the Same Protein in the Database

R-PHYCOERYTHRIN

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1eyx__assembly_1__model_1

1eyx__assembly_1__model_1 | I(q)

1eyx__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)

CRYSTAL STRUCTURE OF R-PHYCOERYTHRIN AT 2.2 ANGSTROMS

1. Protein Identity and Related Structures Protein Identity & Related Structures

R-PHYCOERYTHRIN

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

R-PHYCOERYTHRIN

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1eyx__assembly_1__model_1

1eyx__assembly_1__model_1 | I(q)

1eyx__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)