1gmw

Structure of UreE

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

UREE

KLEBSIELLA AEROGENES

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 4	COPPER (II) ION × 6 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	UREE_KLEAE
Isoform	—
PDB entities	1, 2
Chains and sequence ranges	Author chain A； PDBConstruct 1–143； UniProt 1–143 Author chain B； PDBConstruct 1–143； UniProt 1–143 Author chain C； PDBConstruct 1–143； UniProt 1–143 Author chain D； PDBConstruct 1–143； UniProt 1–143

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1gmw
Deposition date deposition_date	2001-09-24
Structure title title	Structure of UreE
Keywords keywords	METALLOCHAPERONE, CHAPERONE; CHAPERONE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1gmw__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1gmw__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1gmw__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	32.03 Å
Rg (electron density)	31.85 Å
Total Rg	32.15 Å
Atom count	4269
Residues	536
Excluded volume	76556 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1gmw__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	UREE
Molecular weight formula_weight	15924.6 kDa
Mutation mutation	YES
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C
Atom count atom_count	4433

MLYLTQRLEIPAAATASVTLPIDVRVKSRVKVTLNDGRDAGLLLPRGLLLRGGDVLSNEEGTEFVQVIAADEEVSVVRCDDPFMLAKACYALGNRHVPLQIMPGELRYHHDHVLDDMLRQFGLTVTFGQLPFEPEAGAYASES

Source Source

Source organism organism	KLEBSIELLA AEROGENES
NCBI taxonomy ID ncbi_taxonomy_id	28451
Host organism host_organism	ESCHERICHIA COLI

Entity 2 Entity 2 polymer

Description description	UREE
Molecular weight formula_weight	15910.6 kDa
Mutation mutation	YES
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MLYLTQRLEIPAAATASVTLPIDVRVKSRVKVTLNDGRDAGLLLPRGLLLRGGDVLSNEEGTDFVQVIAADEEVSVVRCDDPFMLAKACYALGNRHVPLQIMPGELRYHHDHVLDDMLRQFGLTVTFGQLPFEPEAGAYASES

Source Source

Source organism organism	KLEBSIELLA AEROGENES
NCBI taxonomy ID ncbi_taxonomy_id	28451
Host organism host_organism	ESCHERICHIA COLI

Entity 3 Entity 3 non-polymer

Description description	COPPER (II) ION
Molecular weight formula_weight	63.5 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	164

▼

6. Fold Classification (SCOP + CATH) 16 domains

SCOP 2.08 (8 domains)

Domain ID domain_id	d1gmwa1
Class class	b — All beta proteins
Fold Fold fold	b.107 — Urease metallochaperone UreE, N-terminal domain
Superfamily Superfamily superfamily	b.107.1 — Urease metallochaperone UreE, N-terminal domain
Family Family family	b.107.1.1 — Urease metallochaperone UreE, N-terminal domain

Domain ID domain_id	d1gmwa2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.38 — Urease metallochaperone UreE, C-terminal domain
Family Family family	d.58.38.1 — Urease metallochaperone UreE, C-terminal domain

Domain ID domain_id	d1gmwb1
Class class	b — All beta proteins
Fold Fold fold	b.107 — Urease metallochaperone UreE, N-terminal domain
Superfamily Superfamily superfamily	b.107.1 — Urease metallochaperone UreE, N-terminal domain
Family Family family	b.107.1.1 — Urease metallochaperone UreE, N-terminal domain

Domain ID domain_id	d1gmwb2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.38 — Urease metallochaperone UreE, C-terminal domain
Family Family family	d.58.38.1 — Urease metallochaperone UreE, C-terminal domain

Domain ID domain_id	d1gmwc1
Class class	b — All beta proteins
Fold Fold fold	b.107 — Urease metallochaperone UreE, N-terminal domain
Superfamily Superfamily superfamily	b.107.1 — Urease metallochaperone UreE, N-terminal domain
Family Family family	b.107.1.1 — Urease metallochaperone UreE, N-terminal domain

Domain ID domain_id	d1gmwc2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.38 — Urease metallochaperone UreE, C-terminal domain
Family Family family	d.58.38.1 — Urease metallochaperone UreE, C-terminal domain

Domain ID domain_id	d1gmwd1
Class class	b — All beta proteins
Fold Fold fold	b.107 — Urease metallochaperone UreE, N-terminal domain
Superfamily Superfamily superfamily	b.107.1 — Urease metallochaperone UreE, N-terminal domain
Family Family family	b.107.1.1 — Urease metallochaperone UreE, N-terminal domain

Domain ID domain_id	d1gmwd2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.38 — Urease metallochaperone UreE, C-terminal domain
Family Family family	d.58.38.1 — Urease metallochaperone UreE, C-terminal domain

CATH v4.4 (8 domains)

Domain ID domain_id	1gmwA01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	790 — UreE, C-terminal domain

Domain ID domain_id	1gmwA02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	260 — HSP40/DNAj peptide-binding domain
Homologous superfamily homologous superfamily	20 — Urease metallochaperone UreE, N-terminal domain

Domain ID domain_id	1gmwB01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	790 — UreE, C-terminal domain

Domain ID domain_id	1gmwB02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	260 — HSP40/DNAj peptide-binding domain
Homologous superfamily homologous superfamily	20 — Urease metallochaperone UreE, N-terminal domain

Domain ID domain_id	1gmwC01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	790 — UreE, C-terminal domain

Domain ID domain_id	1gmwC02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	260 — HSP40/DNAj peptide-binding domain
Homologous superfamily homologous superfamily	20 — Urease metallochaperone UreE, N-terminal domain

Domain ID domain_id	1gmwD01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	790 — UreE, C-terminal domain

Domain ID domain_id	1gmwD02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	260 — HSP40/DNAj peptide-binding domain
Homologous superfamily homologous superfamily	20 — Urease metallochaperone UreE, N-terminal domain

▶

Unit-cell length a length_a	43.756 Å
Unit-cell length b length_b	129.905 Å
Unit-cell length c length_c	56.419 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	91.21 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	6

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	1.500 Å
Low-resolution limit resolution_low	17.000 Å
R factor r_factor	0.2230
R_work r_work	0.2230
R_free r_free	0.2610

Structure of UreE

1. Protein Identity and Related Structures Protein Identity & Related Structures

UREE

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1gmw__assembly_1__model_1

1gmw__assembly_1__model_1 | I(q)

1gmw__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 16 domains

SCOP 2.08 (8 domains)

CATH v4.4 (8 domains)

7. Citations (1)

Structure of UreE

1. Protein Identity and Related Structures Protein Identity & Related Structures

UREE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1gmw__assembly_1__model_1

1gmw__assembly_1__model_1 | I(q)

1gmw__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 16 domains

SCOP 2.08 (8 domains)

CATH v4.4 (8 domains)

7. Citations (1)