1kgc

Immune Receptor

Method: X-RAY DIFFRACTION D_max: 76.8 Å Quality: EXCELLENT

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

T-cell receptor alpha chain

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain D； UniProt 1–205	Not recorded	T-cell receptor beta chain × 1 （P01850）	X-RAY DIFFRACTION mmCIF provides none of the parsed experimental conditions	Resolution 1.50 Å R-free 0.234

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 1KGC	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1MI5 The crystal structure of LC13 TcR in complex with HLAB8-EBV peptide complex Deposited 2002-08-21	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain D 1–91（91 aa） Fragment：extracellular domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；PEG, ammonium acetate, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.50 Å R-free 0.288
1QRN CRYSTAL STRUCTURE OF HUMAN A6 TCR COMPLEXED WITH HLA-A2 BOUND TO ALTERED HTLV-1 TAX PEPTIDE P6A Deposited 1999-06-14	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain D 1–91（91 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；287 K；seeding with hanging drop vapor diffusion; 50 mM MOPS pH 7.0, 75 mM MgSO4, 13% PEG 8000, VAPOR DIFFUSION, HANGING DROP, temperature 287K	Resolution 2.80 Å R-free 0.273
1ZGL Crystal structure of 3A6 TCR bound to MBP/HLA-DR2a Deposited 2005-04-21	Different construct Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain M 1–96（96 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å R-free 0.329
1ZGL Crystal structure of 3A6 TCR bound to MBP/HLA-DR2a Deposited 2005-04-21	Different construct Different oligomeric state Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain Q 1–96（96 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å R-free 0.329
1ZGL Crystal structure of 3A6 TCR bound to MBP/HLA-DR2a Deposited 2005-04-21	Different construct Different oligomeric state Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain S 1–96（96 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å R-free 0.329
1ZGL Crystal structure of 3A6 TCR bound to MBP/HLA-DR2a Deposited 2005-04-21	Different construct Different oligomeric state Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain U 1–96（96 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å R-free 0.329
2BNU Structural and kinetic basis for heightened immunogenicity of T cell vaccines Deposited 2005-04-04	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 2–113（112 aa） Fragment：EXTRACELLULAR DOMAINS, RESIDUES 1-91 Chain A 1–91（91 aa） Fragment：EXTRACELLULAR DOMAINS, RESIDUES 1-91 Chain B 2–112（111 aa） Fragment：EXTRACELLULAR DOMAINS, RESIDUES 1-130	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.8；PH 6.8	Resolution 1.40 Å
2ESV Structure of the HLA-E-VMAPRTLIL/KK50.4 TCR complex Deposited 2005-10-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain D 3–91（89 aa） Fragment：Extracellular domain	Not recorded	IOD IODIDE ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；19-22% PEG 3350, 0.2M Potassium Iodide, pH 6.9-7.4, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.60 Å R-free 0.292
2IAL Structural basis for recognition of mutant self by a tumor-specific, MHC class II-restricted TCR Deposited 2006-09-08	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–95（95 aa）	Mutation：T156C	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；295 K；10% PEG-2000 MME, 0.1M Tris, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 1.92 Å R-free 0.265
2IAL Structural basis for recognition of mutant self by a tumor-specific, MHC class II-restricted TCR Deposited 2006-09-08	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1–95（95 aa）	Mutation：T156C	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；295 K；10% PEG-2000 MME, 0.1M Tris, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 1.92 Å R-free 0.265
2IAM Structural basis for recognition of mutant self by a tumor-specific, MHC class II-restricted TCR Deposited 2006-09-08	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain C 1–95（95 aa）	Mutation：T156C	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；295 K；8% PEG6000, 0.1M di-ammonium phosphate, 0.1M Tris, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.80 Å R-free 0.279
2IAN Structural basis for recognition of mutant self by a tumor-specific, MHC class II-restricted TCR Deposited 2006-09-08	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain D 1–95（95 aa）	Mutation：T156C	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；295 K；10% PEG6000, 0.1M di-ammonium phosphate, 0.1M Tris, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.80 Å R-free 0.296
2IAN Structural basis for recognition of mutant self by a tumor-specific, MHC class II-restricted TCR Deposited 2006-09-08	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain I 1–95（95 aa）	Mutation：T156C	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；295 K；10% PEG6000, 0.1M di-ammonium phosphate, 0.1M Tris, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.80 Å R-free 0.296
2IAN Structural basis for recognition of mutant self by a tumor-specific, MHC class II-restricted TCR Deposited 2006-09-08	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain N 1–95（95 aa）	Mutation：T156C	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；295 K；10% PEG6000, 0.1M di-ammonium phosphate, 0.1M Tris, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.80 Å R-free 0.296
2IAN Structural basis for recognition of mutant self by a tumor-specific, MHC class II-restricted TCR Deposited 2006-09-08	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain S 1–95（95 aa）	Mutation：T156C	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；295 K；10% PEG6000, 0.1M di-ammonium phosphate, 0.1M Tris, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.80 Å R-free 0.296
2XN9 Crystal structure of the ternary complex between human T cell receptor, staphylococcal enterotoxin H and human major histocompatibility complex class II Deposited 2010-07-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–95（95 aa） Fragment：EXTRACELLULAR DOMAIN, RESIDUES 1-95	Mutation：YES	GOL GLYCEROL × 4 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7；15% W/V PEG 5000 MME, 0.1 M BIS-TRIS PH 7.0, 0.1 M NACL	Resolution 2.30 Å R-free 0.272
2XNA Crystal structure of the complex between human T cell receptor and staphylococcal enterotoxin Deposited 2010-07-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–95（95 aa） Fragment：EXTRACELLULAR DOMAIN, RESIDUES 1-95	Mutation：YES	GOL GLYCEROL × 3 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；12% W/V PEG 5000 MME, 0.1 M MES PH 6.5, 0.1 M NACL	Resolution 2.10 Å R-free 0.261
3O6F Crystal structure of a human autoimmune TCR MS2-3C8 bound to MHC class II self-ligand MBP/HLA-DR4 Deposited 2010-07-29	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 1–92（92 aa） Fragment：unp residues 1-92	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；293 K；10% (w/v) polyethylene glycol 8000, 0.2 M calcium acetate, and 0.1 M imidazole, VAPOR DIFFUSION, HANGING DROP, temperature 293K, pH 8.5	Resolution 2.80 Å R-free 0.279
3O6F Crystal structure of a human autoimmune TCR MS2-3C8 bound to MHC class II self-ligand MBP/HLA-DR4 Deposited 2010-07-29	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain G 1–92（92 aa） Fragment：unp residues 1-92	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；293 K；10% (w/v) polyethylene glycol 8000, 0.2 M calcium acetate, and 0.1 M imidazole, VAPOR DIFFUSION, HANGING DROP, temperature 293K, pH 8.5	Resolution 2.80 Å R-free 0.279
3O8X Recognition of Glycolipid Antigen by iNKT Cell TCR Deposited 2010-08-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 8–95（88 aa）	Mutation：T163C	GSL (2S,3R)-3-HYDROXY-2-(TETRADECANOYLAMINO)OCTADECYL ALPHA-D-GALACTOPYRANOSIDURONIC ACID × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.4；295 K；18% polyethylene glycol 3350, 0.2 M ammonium citrate dibasic, pH 7.4, VAPOR DIFFUSION, SITTING DROP, temperature 295K	Resolution 2.74 Å R-free 0.253
3O9W Recognition of a Glycolipid Antigen by the iNKT Cell TCR Deposited 2010-08-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 8–95（88 aa）	Mutation：T163C	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 1O2 (2S)-3-(alpha-D-galactopyranosyloxy)-2-(hexadecanoyloxy)propyl (9Z)-octadec-9-enoate × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.4；295 K；20% polyethylene glycol 3350, 0.1 M citrate pH 5, VAPOR DIFFUSION, SITTING DROP, temperature 295K	Resolution 2.80 Å R-free 0.258
4UDT T cell receptor (TRAV22,TRBV7-9) structure Deposited 2014-12-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 2–95（94 aa） Fragment：VARIABLE DOMAIN TRAV22, RESIDUES 1-112, CONSTANT DOMAIN TRAC1, RESIDUES 2-95	Mutation：YES	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；22% W/V PEG 2000 MME, 0.1 M NH4CL PH 8.5, 0.1 M NACL	Resolution 1.35 Å R-free 0.193
4UDU Crystal structure of staphylococcal enterotoxin E in complex with a T cell receptor Deposited 2014-12-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 2–95（94 aa） Fragment：VARIABLE DOMAIN TRAV22, RESIDUES 1-112, CONSTANT DOMAIN TRAC1, RESIDUES 2-95	Mutation：YES	ZN ZINC ION × 1 NA SODIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 9；15% W/V PEG 20000, 0.1 M GLYCINE PH 9.0, 0.1 M NACL	Resolution 2.50 Å R-free 0.255
4ZDH Crystal structure of JKA6 TCR Deposited 2015-04-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 3–93（91 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；0.2 M LITHIUM SULFATE, 0.1 M TRIS-HCL, PEG 4000	Resolution 2.10 Å R-free 0.224
5BRZ MAGE-A3 reactive TCR in complex with MAGE-A3 in HLA-A1 Deposited 2015-06-01	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain D 4–84（81 aa）	Not recorded	SO4 SULFATE ION × 7	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；0.2M ammonium chloride, 0.1M HEPES pH7, 15% PEG 8000	Resolution 2.62 Å R-free 0.268
5BS0 MAGE-A3 Reactive TCR in complex with Titin Epitope in HLA-A1 Deposited 2015-06-01	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain D 3–84（82 aa）	Not recorded	GOL GLYCEROL × 1 SO4 SULFATE ION × 11	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；291 K；0.2M Ammonium Chloride, 0.1M MES, 20% PEG 4000	Resolution 2.40 Å R-free 0.262
6DKP The complex among DMF5(alpha-D26Y, alpha-Y50A,beta-L98W) TCR, human Class I MHC HLA-A2 and MART-1(26-35)(A27L) peptide Deposited 2018-05-30	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain D 1–91（91 aa）	Mutation：D26Y, Y50A,D26Y, Y50A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；298 K；12% Peg 3350, 250mM MgCl2, 0.1M HEPES	Resolution 2.97 Å R-free 0.286
6JXR Structure of human T cell receptor-CD3 complex Deposited 2019-04-24	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 8 PDB declaration: octameric	Chain m 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.70 Å
7FJD Cryo-EM structure of a membrane protein(WT) Deposited 2021-08-03	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 8 PDB declaration: octameric	Chain m 1–140（140 aa）	Not recorded	CLR CHOLESTEROL × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.20 Å
7FJE Cryo-EM structure of a membrane protein(LL) Deposited 2021-08-03	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 8 PDB declaration: octameric	Chain m 1–140（140 aa）	Not recorded	CLR CHOLESTEROL × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.00 Å
7FJF Cryo-EM structure of a membrane protein(CS) Deposited 2021-08-03	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 8 PDB declaration: octameric	Chain m 1–140（140 aa）	Not recorded	C3S CHOLEST-5-EN-3-YL HYDROGEN SULFATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.10 Å
7NDT UL40:01 TCR in complex with HLA-E with a non-natural amino acid Deposited 2021-02-02	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 10 PDB declaration: decameric	Chain DDD 1–85（85 aa） Chain III 1–85（85 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；12% (w/v) PEG 8000, 55 mM MOPS pH 6.5	Resolution 3.00 Å R-free 0.269
7RYL T cell receptor CO3 Deposited 2021-08-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1–93（93 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.15M Ammonium sulfate, 15% PEG 4000, 0.1 MES pH 6	Resolution 2.00 Å R-free 0.247
7RYM CD1a-endo-gdTCR complex Deposited 2021-08-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 1–93（93 aa）	Not recorded	PEG DI(HYDROXYETHYL)ETHER × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；20% PEG3350, 0.2M Ammonium Sulfate	Resolution 3.20 Å R-free 0.286
7RYN CD1a-sulfatide-gdTCR complex Deposited 2021-08-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 1–93（93 aa）	Not recorded	CIS (15Z)-N-((1S,2R,3E)-2-HYDROXY-1-{[(3-O-SULFO-BETA-D-GALACTOPYRANOSYL)OXY]METHYL}HEPTADEC-3-ENYL)TETRACOS-15-ENAMIDE × 1 EDO 1,2-ETHANEDIOL × 6 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 PEG DI(HYDROXYETHYL)ETHER × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；15% PEG 4000, 0.15M Ammonium Sulfate, 0.1M MES pH6	Resolution 2.70 Å R-free 0.268
7RYO CD1a-dideoxymycobactin-gdTCR complex Deposited 2021-08-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 1–93（93 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 WGR dideoxymycobactin-838 × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；20% PEG 3350, 0.2M Ammonium sulfate	Resolution 3.00 Å R-free 0.267
7T2B Crystal structure of the 5F TCR in complex with HLA-DP4-Ply Deposited 2021-12-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain D 1–93（93 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 EDO 1,2-ETHANEDIOL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293.15 K；Tacsimate pH 8, PEG 3350	Resolution 2.80 Å R-free 0.250
7T2B Crystal structure of the 5F TCR in complex with HLA-DP4-Ply Deposited 2021-12-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain I 1–93（93 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293.15 K；Tacsimate pH 8, PEG 3350	Resolution 2.80 Å R-free 0.250
7T2B Crystal structure of the 5F TCR in complex with HLA-DP4-Ply Deposited 2021-12-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain N 1–93（93 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293.15 K；Tacsimate pH 8, PEG 3350	Resolution 2.80 Å R-free 0.250
7T2B Crystal structure of the 5F TCR in complex with HLA-DP4-Ply Deposited 2021-12-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain S 1–93（93 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293.15 K；Tacsimate pH 8, PEG 3350	Resolution 2.80 Å R-free 0.250
7T2C Crystal structure of the B5 TCR in complex with HLA-DP4-Ply Deposited 2021-12-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain D 1–93（93 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293.15 K；Calcium acetate, PEG 3350, Tris-HCl pH 8.5	Resolution 3.10 Å R-free 0.257
7T2D Crystal structure of the B1 TCR in complex with HLA-DP4-Ply Deposited 2021-12-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain D 1–93（93 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277.15 K；Potassium sodium tartrate, Tris-HCl pH 8	Resolution 3.40 Å R-free 0.271
7T2D Crystal structure of the B1 TCR in complex with HLA-DP4-Ply Deposited 2021-12-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain I 1–93（93 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277.15 K；Potassium sodium tartrate, Tris-HCl pH 8	Resolution 3.40 Å R-free 0.271
7T2D Crystal structure of the B1 TCR in complex with HLA-DP4-Ply Deposited 2021-12-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain N 1–93（93 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277.15 K；Potassium sodium tartrate, Tris-HCl pH 8	Resolution 3.40 Å R-free 0.271
7T2D Crystal structure of the B1 TCR in complex with HLA-DP4-Ply Deposited 2021-12-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain S 1–93（93 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277.15 K；Potassium sodium tartrate, Tris-HCl pH 8	Resolution 3.40 Å R-free 0.271
8WYI T cell receptor delta 2 gamma 9 with TCRD TM domain chimera of TRAC Deposited 2023-10-31	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 8 PDB declaration: octameric	Chain m 121–140（20 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
9WBD Crystal structure of HLA-B*07:02 in complex with SPR epitope and Q04 TCR Deposited 2025-08-13	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain A 1–93（93 aa）	Not recorded	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；289 K；Tris-HCl, calcium chloride, PEG 3350	Resolution 2.75 Å R-free 0.270
9WBD Crystal structure of HLA-B*07:02 in complex with SPR epitope and Q04 TCR Deposited 2025-08-13	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain F 1–93（93 aa）	Not recorded	PEG DI(HYDROXYETHYL)ETHER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；289 K；Tris-HCl, calcium chloride, PEG 3350	Resolution 2.75 Å R-free 0.270
9WBD Crystal structure of HLA-B*07:02 in complex with SPR epitope and Q04 TCR Deposited 2025-08-13	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain K 1–93（93 aa）	Not recorded	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；289 K；Tris-HCl, calcium chloride, PEG 3350	Resolution 2.75 Å R-free 0.270
9WBD Crystal structure of HLA-B*07:02 in complex with SPR epitope and Q04 TCR Deposited 2025-08-13	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain P 1–93（93 aa）	Not recorded	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；289 K；Tris-HCl, calcium chloride, PEG 3350	Resolution 2.75 Å R-free 0.270
9ZZV Human T-cell receptor (TCR) with computationally designed orthogonal interface Deposited 2026-01-08	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–94（94 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；100 mM sodium cacodylate pH 6.5, 1.26 M ammonium sulfate	Resolution 2.05 Å R-free 0.248

34 other PDB entries and 51 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	TCA_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain D； PDBConstruct 2–206； UniProt 1–205

T-cell receptor beta chain

Homo sapiens

UniProt P01850

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain E； UniProt 1–241	Not recorded	T-cell receptor alpha chain × 1 （P01848）	X-RAY DIFFRACTION mmCIF provides none of the parsed experimental conditions	Resolution 1.50 Å R-free 0.234

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 1KGC	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1FYT CRYSTAL STRUCTURE OF A COMPLEX OF A HUMAN ALPHA/BETA-T CELL RECEPTOR, INFLUENZA HA ANTIGEN PEPTIDE, AND MHC CLASS II MOLECULE, HLA-DR1 Deposited 2000-10-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 22–266（245 aa） Fragment：EXTRACELLULAR DOMAIN	Mutation：C192S	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；291 K；11% PEG 8000, 1 M NaCl, 100 mM HEPES, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 18K	Resolution 2.60 Å R-free 0.255
1KTK Complex of Streptococcal pyrogenic enterotoxin C (SpeC) with a human T cell receptor beta chain (Vbeta2.1) Deposited 2002-01-16	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain E 1–130（130 aa） Chain F 1–130（130 aa）	Mutation：C13A, C191A Mutation：C13A, C191A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；298 K；15% PEG 8000, 0.2 M MgCl2, pH 8.0, VAPOR DIFFUSION, HANGING DROP at 298K	Resolution 3.00 Å R-free 0.334
1MI5 The crystal structure of LC13 TcR in complex with HLAB8-EBV peptide complex Deposited 2002-08-21	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 1–130（130 aa） Fragment：extracellular domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；PEG, ammonium acetate, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.50 Å R-free 0.288
1OGA A structural basis for immunodominant human T-cell receptor recognition. Deposited 2003-04-28	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 1–130（130 aa） Fragment：EXTRACELLULAR, RESIDUES 1-130	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；14% PEG8000, 50MM MES PH 6.5	Resolution 1.40 Å R-free 0.231
1YMM TCR/HLA-DR2b/MBP-peptide complex Deposited 2005-01-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 16–264（249 aa）	Mutation：C13S, C193S	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions hanging drop；pH 7；293 K；Na-tartrate, ammonium formate, HEPES, pH 7.0, hanging drop, temperature 293K	Resolution 3.50 Å R-free 0.318
1ZGL Crystal structure of 3A6 TCR bound to MBP/HLA-DR2a Deposited 2005-04-21	Different construct Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain P 1–131（131 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å R-free 0.329
1ZGL Crystal structure of 3A6 TCR bound to MBP/HLA-DR2a Deposited 2005-04-21	Different construct Different oligomeric state Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain R 1–131（131 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å R-free 0.329
1ZGL Crystal structure of 3A6 TCR bound to MBP/HLA-DR2a Deposited 2005-04-21	Different construct Different oligomeric state Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain T 1–131（131 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å R-free 0.329
1ZGL Crystal structure of 3A6 TCR bound to MBP/HLA-DR2a Deposited 2005-04-21	Different construct Different oligomeric state Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain V 1–131（131 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å R-free 0.329
2AXH Crystal structures of T cell receptor beta chains related to rheumatoid arthritis Deposited 2005-09-05	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–130（130 aa） Fragment：extracellular domain Chain B 1–130（130 aa） Fragment：extracellular domain	Mutation：F104Y, C187S Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：F104Y, C187S Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；0.6-0.7m sodium citrate, 0.1M HEPES, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.70 Å R-free 0.280
2AXH Crystal structures of T cell receptor beta chains related to rheumatoid arthritis Deposited 2005-09-05	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 1–130（130 aa） Fragment：extracellular domain Chain B 1–130（130 aa） Fragment：extracellular domain	Mutation：F104Y, C187S Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：F104Y, C187S Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；0.6-0.7m sodium citrate, 0.1M HEPES, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.70 Å R-free 0.280
2AXH Crystal structures of T cell receptor beta chains related to rheumatoid arthritis Deposited 2005-09-05	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–130（130 aa） Fragment：extracellular domain Chain B 1–130（130 aa） Fragment：extracellular domain	Mutation：F104Y, C187S Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：F104Y, C187S Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；0.6-0.7m sodium citrate, 0.1M HEPES, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.70 Å R-free 0.280
2AXH Crystal structures of T cell receptor beta chains related to rheumatoid arthritis Deposited 2005-09-05	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–130（130 aa） Fragment：extracellular domain Chain B 1–130（130 aa） Fragment：extracellular domain	Mutation：F104Y, C187S Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：F104Y, C187S Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；0.6-0.7m sodium citrate, 0.1M HEPES, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.70 Å R-free 0.280
2BNQ Structural and kinetic basis for heightened immunogenicity of T cell vaccines Deposited 2005-03-31	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 1–130（130 aa） Fragment：EXTRACELLULAR, RESIDUES 1-130	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.2；pH 7.20	Resolution 1.70 Å R-free 0.253
2BNR Structural and kinetic basis for heightened immunogenicity of T cell vaccines Deposited 2005-03-31	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 1–130（130 aa） Fragment：EXTRACELLULAR, RESIDUES 1-130	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.2；pH 7.20	Resolution 1.90 Å
2BNU Structural and kinetic basis for heightened immunogenicity of T cell vaccines Deposited 2005-04-04	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–130（130 aa） Fragment：EXTRACELLULAR DOMAINS, RESIDUES 1-130	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.8；PH 6.8	Resolution 1.40 Å
2ESV Structure of the HLA-E-VMAPRTLIL/KK50.4 TCR complex Deposited 2005-10-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 1–130（130 aa） Fragment：Extracellular domain	Not recorded	IOD IODIDE ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；19-22% PEG 3350, 0.2M Potassium Iodide, pH 6.9-7.4, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.60 Å R-free 0.292
2IAL Structural basis for recognition of mutant self by a tumor-specific, MHC class II-restricted TCR Deposited 2006-09-08	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–130（130 aa）	Mutation：S167C	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；295 K；10% PEG-2000 MME, 0.1M Tris, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 1.92 Å R-free 0.265
2IAL Structural basis for recognition of mutant self by a tumor-specific, MHC class II-restricted TCR Deposited 2006-09-08	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1–130（130 aa）	Mutation：S167C	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；295 K；10% PEG-2000 MME, 0.1M Tris, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 1.92 Å R-free 0.265
2IAM Structural basis for recognition of mutant self by a tumor-specific, MHC class II-restricted TCR Deposited 2006-09-08	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain D 1–130（130 aa）	Mutation：S167C	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；295 K；8% PEG6000, 0.1M di-ammonium phosphate, 0.1M Tris, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.80 Å R-free 0.279
2IAN Structural basis for recognition of mutant self by a tumor-specific, MHC class II-restricted TCR Deposited 2006-09-08	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 1–130（130 aa）	Mutation：S167C	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；295 K；10% PEG6000, 0.1M di-ammonium phosphate, 0.1M Tris, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.80 Å R-free 0.296
2IAN Structural basis for recognition of mutant self by a tumor-specific, MHC class II-restricted TCR Deposited 2006-09-08	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain J 1–130（130 aa）	Mutation：S167C	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；295 K；10% PEG6000, 0.1M di-ammonium phosphate, 0.1M Tris, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.80 Å R-free 0.296
2IAN Structural basis for recognition of mutant self by a tumor-specific, MHC class II-restricted TCR Deposited 2006-09-08	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain O 1–130（130 aa）	Mutation：S167C	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；295 K；10% PEG6000, 0.1M di-ammonium phosphate, 0.1M Tris, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.80 Å R-free 0.296
2IAN Structural basis for recognition of mutant self by a tumor-specific, MHC class II-restricted TCR Deposited 2006-09-08	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain T 1–130（130 aa）	Mutation：S167C	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；295 K；10% PEG6000, 0.1M di-ammonium phosphate, 0.1M Tris, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.80 Å R-free 0.296
2XN9 Crystal structure of the ternary complex between human T cell receptor, staphylococcal enterotoxin H and human major histocompatibility complex class II Deposited 2010-07-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 1–130（130 aa） Fragment：EXTRACELLULAR DOMAIN, RESIDUES 1-130	Mutation：YES	GOL GLYCEROL × 4 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7；15% W/V PEG 5000 MME, 0.1 M BIS-TRIS PH 7.0, 0.1 M NACL	Resolution 2.30 Å R-free 0.272
2XNA Crystal structure of the complex between human T cell receptor and staphylococcal enterotoxin Deposited 2010-07-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 1–130（130 aa） Fragment：EXTRACELLULAR DOMAIN, RESIDUES 1-130	Mutation：YES	GOL GLYCEROL × 3 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；12% W/V PEG 5000 MME, 0.1 M MES PH 6.5, 0.1 M NACL	Resolution 2.10 Å R-free 0.261
4MNQ TCR-peptide specificity overrides affinity enhancing TCR-MHC interactions Deposited 2013-09-11	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 2–130（129 aa）	Not recorded	GOL GLYCEROL × 1 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；291 K；TRIS 0.02M, 20% PEG 4000, 0.01M NaCl, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 2.74 Å R-free 0.284
7RYL T cell receptor CO3 Deposited 2021-08-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1–129（129 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.15M Ammonium sulfate, 15% PEG 4000, 0.1 MES pH 6	Resolution 2.00 Å R-free 0.247
7RYM CD1a-endo-gdTCR complex Deposited 2021-08-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 1–129（129 aa）	Not recorded	PEG DI(HYDROXYETHYL)ETHER × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；20% PEG3350, 0.2M Ammonium Sulfate	Resolution 3.20 Å R-free 0.286
7RYN CD1a-sulfatide-gdTCR complex Deposited 2021-08-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 1–129（129 aa）	Not recorded	CIS (15Z)-N-((1S,2R,3E)-2-HYDROXY-1-{[(3-O-SULFO-BETA-D-GALACTOPYRANOSYL)OXY]METHYL}HEPTADEC-3-ENYL)TETRACOS-15-ENAMIDE × 1 EDO 1,2-ETHANEDIOL × 6 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 PEG DI(HYDROXYETHYL)ETHER × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；15% PEG 4000, 0.15M Ammonium Sulfate, 0.1M MES pH6	Resolution 2.70 Å R-free 0.268
7RYO CD1a-dideoxymycobactin-gdTCR complex Deposited 2021-08-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 1–129（129 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 WGR dideoxymycobactin-838 × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；20% PEG 3350, 0.2M Ammonium sulfate	Resolution 3.00 Å R-free 0.267
7T2B Crystal structure of the 5F TCR in complex with HLA-DP4-Ply Deposited 2021-12-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 1–129（129 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 EDO 1,2-ETHANEDIOL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293.15 K；Tacsimate pH 8, PEG 3350	Resolution 2.80 Å R-free 0.250
7T2B Crystal structure of the 5F TCR in complex with HLA-DP4-Ply Deposited 2021-12-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain J 1–129（129 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293.15 K；Tacsimate pH 8, PEG 3350	Resolution 2.80 Å R-free 0.250
7T2B Crystal structure of the 5F TCR in complex with HLA-DP4-Ply Deposited 2021-12-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain O 1–129（129 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293.15 K；Tacsimate pH 8, PEG 3350	Resolution 2.80 Å R-free 0.250
7T2B Crystal structure of the 5F TCR in complex with HLA-DP4-Ply Deposited 2021-12-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain T 1–129（129 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293.15 K；Tacsimate pH 8, PEG 3350	Resolution 2.80 Å R-free 0.250
7T2C Crystal structure of the B5 TCR in complex with HLA-DP4-Ply Deposited 2021-12-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 1–129（129 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293.15 K；Calcium acetate, PEG 3350, Tris-HCl pH 8.5	Resolution 3.10 Å R-free 0.257
7T2D Crystal structure of the B1 TCR in complex with HLA-DP4-Ply Deposited 2021-12-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 1–129（129 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277.15 K；Potassium sodium tartrate, Tris-HCl pH 8	Resolution 3.40 Å R-free 0.271
7T2D Crystal structure of the B1 TCR in complex with HLA-DP4-Ply Deposited 2021-12-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain J 1–129（129 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277.15 K；Potassium sodium tartrate, Tris-HCl pH 8	Resolution 3.40 Å R-free 0.271
7T2D Crystal structure of the B1 TCR in complex with HLA-DP4-Ply Deposited 2021-12-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain O 1–129（129 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277.15 K；Potassium sodium tartrate, Tris-HCl pH 8	Resolution 3.40 Å R-free 0.271
7T2D Crystal structure of the B1 TCR in complex with HLA-DP4-Ply Deposited 2021-12-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain T 1–129（129 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277.15 K；Potassium sodium tartrate, Tris-HCl pH 8	Resolution 3.40 Å R-free 0.271

24 other PDB entries and 40 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	TCB_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain E； PDBConstruct 2–242； UniProt 1–241

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1kgc
Deposition date deposition_date	2001-11-26
Structure title title	Immune Receptor
Keywords keywords	T-cell receptor, LC13 clone, IMMUNE SYSTEM; IMMUNE SYSTEM
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	25.09 Å
Radius of gyration Rg (electron density) rg_electron	23.98 Å
Forward intensity I(0) i0	43493900.00
Molecular weight molecular_weight	49391.0 kDa
Excluded volume excluded_volume	61078 Å³
Envelope volume envelope_volume	76360 Å³
Hydration-shell volume shell_volume	26438 Å³
Envelope diameter envelope_diameter	78.2 Å
Shell Rg shell_rg	31.20 Å
Envelope Rg envelope_rg	23.85 Å
Shape Rg shape_rg	23.98 Å
Total Rg total_rg	24.84 Å
Total atoms total_atoms	3485
Residues n_residues	441
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	76.8 Å
Rg (real space) rg_real	25.00 Å
Rg uncertainty (real space) rg_real_error	0.39 Å
I(0) (real space) i0_real	4.3490e+07
I(0) uncertainty (real space) i0_real_error	6.3300e+05
Rg (reciprocal space) rg_reciprocal	25.03 Å
I(0) (reciprocal space) i0_reciprocal	43490000.0000
Solution quality estimate total_estimate	0.9156
Solution quality rating solution_quality	EXCELLENT a EXCELLENT solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	75.5 Å
Skewness Skewness skewness	0.165
Kurtosis Kurtosis kurtosis	-0.596
Angular range angular_range	— – 0.3150 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	10290000.0000
Real-space data points n_real_points	64
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.969; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.999; Smooth: 0.991

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	T-cell receptor alpha chain
Molecular weight formula_weight	22849.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D
Atom count atom_count	4171

MKTTQPNSMESNEEEPVHLPCNHSTISGTDYIHWYRQLPSQGPEYVIHGLTSNVNNRMASLAIAEDRKSSTLILHRATLRDAAVYYCILPLAGGTSYGKLTFGQGTILTVHPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESS

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	T-cell receptor beta chain
Molecular weight formula_weight	27316.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MGVSQSPRYKVAKRGQDVALRCDPISGHVSLFWYQQALGQGPEFLTYFQNEAQLDKSGLPSDRFFAERPEGSVSTLKIQRTQQEDSAVYLCASSLGQAYEQYFGPGTRLTVTEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	686

▼

7. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d1kgcd1
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.1 — Immunoglobulin
Family Family family	b.1.1.1 — V set domains (antibody variable domain-like)

Domain ID domain_id	d1kgcd2
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.1 — Immunoglobulin
Family Family family	b.1.1.2 — C1 set domains (antibody constant domain-like)

Domain ID domain_id	d1kgce1
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.1 — Immunoglobulin
Family Family family	b.1.1.1 — V set domains (antibody variable domain-like)

Domain ID domain_id	d1kgce2
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.1 — Immunoglobulin
Family Family family	b.1.1.2 — C1 set domains (antibody constant domain-like)

CATH v4.4 (4 domains)

Domain ID domain_id	1kgcD01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	1kgcD02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	1kgcE01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	1kgcE02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

▶

8. Citations (1)

▶

Unit-cell length a length_a	45.796 Å
Unit-cell length b length_b	68.110 Å
Unit-cell length c length_c	160.497 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	1.500 Å
Low-resolution limit resolution_low	50.000 Å
R factor r_factor	—
R_work r_work	0.2113
R_free r_free	0.2337

fit	/app/data/saxs_computation/kg/1kgc/1kgc.fit
pddf	/app/data/pr_computation/kg/1kgc/1kgc.pr.out
profile	/app/data/saxs_computation/kg/1kgc/1kgc.dat

Immune Receptor

1. Protein Identity and Related Structures Protein Identity & Related Structures

T-cell receptor alpha chain

State in the Current Structure

Other States of the Same Protein in the Database

T-cell receptor beta chain

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 water

7. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)