SAXSdb — 1kn2

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

IG ANTIBODY D2.3 (LIGHT CHAIN)

OrganismNot specified

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain L； UniProt 21–239	Not recorded	IG ANTIBODY D2.3 (HEAVY CHAIN) × 1 ZN ZINC ION × 7 PNE PARA-NITROPHENYL PHOSPHONOBUTANOYL L-ALANINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7；PEG600, ZnSO4, cacodylate, pH 7.00, VAPOR DIFFUSION, HANGING DROP	Resolution 1.90 Å R-free 0.238
2	Protein heterocomplex Heteromer Protein × 4 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain L； UniProt 21–239	Not recorded	IG ANTIBODY D2.3 (HEAVY CHAIN) × 2 ZN ZINC ION × 14 PNE PARA-NITROPHENYL PHOSPHONOBUTANOYL L-ALANINE × 2	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7；PEG600, ZnSO4, cacodylate, pH 7.00, VAPOR DIFFUSION, HANGING DROP	Resolution 1.90 Å R-free 0.238
3	Protein heterocomplex Heteromer Protein × 4 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain L； UniProt 21–239	Not recorded	IG ANTIBODY D2.3 (HEAVY CHAIN) × 2 ZN ZINC ION × 14 PNE PARA-NITROPHENYL PHOSPHONOBUTANOYL L-ALANINE × 2	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7；PEG600, ZnSO4, cacodylate, pH 7.00, VAPOR DIFFUSION, HANGING DROP	Resolution 1.90 Å R-free 0.238
4	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain L； UniProt 21–239	Not recorded	IG ANTIBODY D2.3 (HEAVY CHAIN) × 1 ZN ZINC ION × 7 PNE PARA-NITROPHENYL PHOSPHONOBUTANOYL L-ALANINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7；PEG600, ZnSO4, cacodylate, pH 7.00, VAPOR DIFFUSION, HANGING DROP	Resolution 1.90 Å R-free 0.238

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 1KN2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1KN4 CATALYTIC ANTIBODY D2.3 COMPLEX Deposited 2001-12-18	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain L 21–239（219 aa）	Not recorded	ZN ZINC ION × 7 PDE PARA-NITROPHENYL PHOSPHONOBUTANOYL D-ALANINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；PEG600, ZnSO4, Cacodylate, pH 7.00, VAPOR DIFFUSION, HANGING DROP	Resolution 1.90 Å R-free 0.246
1KN4 CATALYTIC ANTIBODY D2.3 COMPLEX Deposited 2001-12-18	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain L 21–239（219 aa）	Not recorded	ZN ZINC ION × 14 PDE PARA-NITROPHENYL PHOSPHONOBUTANOYL D-ALANINE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；PEG600, ZnSO4, Cacodylate, pH 7.00, VAPOR DIFFUSION, HANGING DROP	Resolution 1.90 Å R-free 0.246
1KN4 CATALYTIC ANTIBODY D2.3 COMPLEX Deposited 2001-12-18	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain L 21–239（219 aa）	Not recorded	ZN ZINC ION × 14 PDE PARA-NITROPHENYL PHOSPHONOBUTANOYL D-ALANINE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；PEG600, ZnSO4, Cacodylate, pH 7.00, VAPOR DIFFUSION, HANGING DROP	Resolution 1.90 Å R-free 0.246
1KN4 CATALYTIC ANTIBODY D2.3 COMPLEX Deposited 2001-12-18	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain L 21–239（219 aa）	Not recorded	ZN ZINC ION × 7 PDE PARA-NITROPHENYL PHOSPHONOBUTANOYL D-ALANINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；PEG600, ZnSO4, Cacodylate, pH 7.00, VAPOR DIFFUSION, HANGING DROP	Resolution 1.90 Å R-free 0.246
1ND0 CATIONIC CYCLIZATION ANTIBODY 4C6 COMPLEX WITH TRANSITION STATE ANALOG Deposited 2002-12-05	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 21–239（219 aa） Fragment：IMMUNOGLOBULIN FAB FRAGMENT, light chain Chain C 21–239（219 aa） Fragment：IMMUNOGLOBULIN FAB FRAGMENT, light chain	Not recorded	DP4 (1s,4s)-4-[dimethyl(phenyl)silyl]-1-methylpiperidine 1-oxide × 2 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 5.5；295 K；ammonium sulfate, dioxane, tri-sodium citrate dihydrate, pH 5.5, evaporation, temperature 295K	Resolution 2.45 Å R-free 0.286
1ND0 CATIONIC CYCLIZATION ANTIBODY 4C6 COMPLEX WITH TRANSITION STATE ANALOG Deposited 2002-12-05	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain E 21–239（219 aa） Fragment：IMMUNOGLOBULIN FAB FRAGMENT, light chain Chain G 21–239（219 aa） Fragment：IMMUNOGLOBULIN FAB FRAGMENT, light chain	Not recorded	DP4 (1s,4s)-4-[dimethyl(phenyl)silyl]-1-methylpiperidine 1-oxide × 2 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 5.5；295 K；ammonium sulfate, dioxane, tri-sodium citrate dihydrate, pH 5.5, evaporation, temperature 295K	Resolution 2.45 Å R-free 0.286
1ND0 CATIONIC CYCLIZATION ANTIBODY 4C6 COMPLEX WITH TRANSITION STATE ANALOG Deposited 2002-12-05	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 21–239（219 aa） Fragment：IMMUNOGLOBULIN FAB FRAGMENT, light chain	Not recorded	DP4 (1s,4s)-4-[dimethyl(phenyl)silyl]-1-methylpiperidine 1-oxide × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 5.5；295 K；ammonium sulfate, dioxane, tri-sodium citrate dihydrate, pH 5.5, evaporation, temperature 295K	Resolution 2.45 Å R-free 0.286
1ND0 CATIONIC CYCLIZATION ANTIBODY 4C6 COMPLEX WITH TRANSITION STATE ANALOG Deposited 2002-12-05	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 21–239（219 aa） Fragment：IMMUNOGLOBULIN FAB FRAGMENT, light chain	Not recorded	DP4 (1s,4s)-4-[dimethyl(phenyl)silyl]-1-methylpiperidine 1-oxide × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 5.5；295 K；ammonium sulfate, dioxane, tri-sodium citrate dihydrate, pH 5.5, evaporation, temperature 295K	Resolution 2.45 Å R-free 0.286
1ND0 CATIONIC CYCLIZATION ANTIBODY 4C6 COMPLEX WITH TRANSITION STATE ANALOG Deposited 2002-12-05	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 21–239（219 aa） Fragment：IMMUNOGLOBULIN FAB FRAGMENT, light chain	Not recorded	DP4 (1s,4s)-4-[dimethyl(phenyl)silyl]-1-methylpiperidine 1-oxide × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 5.5；295 K；ammonium sulfate, dioxane, tri-sodium citrate dihydrate, pH 5.5, evaporation, temperature 295K	Resolution 2.45 Å R-free 0.286
1ND0 CATIONIC CYCLIZATION ANTIBODY 4C6 COMPLEX WITH TRANSITION STATE ANALOG Deposited 2002-12-05	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 21–239（219 aa） Fragment：IMMUNOGLOBULIN FAB FRAGMENT, light chain	Not recorded	DP4 (1s,4s)-4-[dimethyl(phenyl)silyl]-1-methylpiperidine 1-oxide × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 5.5；295 K；ammonium sulfate, dioxane, tri-sodium citrate dihydrate, pH 5.5, evaporation, temperature 295K	Resolution 2.45 Å R-free 0.286
1RU9 Crystal Structure (A) of u.v.-irradiated cationic cyclization antibody 4C6 Fab at pH 4.6 with a data set collected in-house. Deposited 2003-12-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain L 21–239（219 aa） Fragment：fab	Non-standard monomer：Yes (specific site not provided by mmCIF)	GOL GLYCEROL × 5 ACT ACETATE ION × 1 BEZ BENZOIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.6；295 K；0.1M sodium acetate, pH 4.6, 0.2 M ammonium acetate, 15% (w/v) PEG 4000, VAPOR DIFFUSION, SITTING DROP, temperature 295K	Resolution 2.50 Å R-free 0.247
1RUA Crystal structure (B) of u.v.-irradiated cationic cyclization antibody 4C6 fab at pH 4.6 with a data set collected at SSRL beamline 11-1. Deposited 2003-12-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain L 21–239（219 aa） Fragment：fab	Non-standard monomer：Yes (specific site not provided by mmCIF)	ACT ACETATE ION × 1 GOL GLYCEROL × 3 BEZ BENZOIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.6；295 K；0.1M sodium acetate, 0.2 M ammonium acetate, 15% (w/v) PEG 4000, pH 4.6, VAPOR DIFFUSION, SITTING DROP, temperature 295K	Resolution 1.75 Å R-free 0.251
1RUK Crystal structure (C) of native cationic cyclization antibody 4C6 fab at pH 4.6 with a data set collected at SSRL beamline 9-1 Deposited 2003-12-11	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain L 21–239（219 aa） Fragment：fab	Not recorded	ACT ACETATE ION × 1 BEZ BENZOIC ACID × 1 GOL GLYCEROL × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.6；295 K；0.1M sodium acetate, 0.2 M ammonium acetate, 15% (w/v) PEG 4000, pH 4.6, VAPOR DIFFUSION, SITTING DROP, temperature 295K	Resolution 1.40 Å R-free 0.210
1RUL Crystal Structure (D) of u.v.-irradiated cationic cyclization antibody 4C6 Fab at pH 5.6 with a data set collected at SSRL beamline 11-1. Deposited 2003-12-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain L 21–239（219 aa） Fragment：fab	Non-standard monomer：Yes (specific site not provided by mmCIF)	ACT ACETATE ION × 1 GOL GLYCEROL × 4 BEZ BENZOIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.6；295 K；0.1 M tri-sodium citrate, 0.2M ammonium acetate, 15% (w/v) PEG 4000, pH 5.6, VAPOR DIFFUSION, SITTING DROP, temperature 295K	Resolution 1.88 Å R-free 0.283
1RUM Crystal structure (F) of H2O2-soaked cationic cyclization antibody 4C6 fab at pH 8.5 with a data set collected at SSRL beamline 9-1. Deposited 2003-12-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain L 21–239（219 aa） Fragment：fab	Non-standard monomer：Yes (specific site not provided by mmCIF)	BEZ BENZOIC ACID × 1 GOL GLYCEROL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；295 K；0.1 M tris hydrochloride, pH 8.5, 0.2 M sodium acetate, 15% (w/v) PEG 4000, VAPOR DIFFUSION, SITTING DROP, temperature 295K	Resolution 1.48 Å R-free 0.245
1RUP Crystal structure (G) of native cationic cyclization antibody 4C6 fab at pH 8.5 with a data set collected at APS beamline 19-ID Deposited 2003-12-11	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain L 21–239（219 aa） Fragment：fab	Not recorded	BEZ BENZOIC ACID × 1 GOL GLYCEROL × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；295 K；0.1 M tris hydrochloride, 0.2 M sodium acetate, 15% (w/v) PEG 4000 , pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 295K	Resolution 1.40 Å R-free 0.212

8 other PDB entries and 16 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	Q8K0F8_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain L； PDBConstruct 1–219； UniProt 21–239

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1kn2
Deposition date deposition_date	2001-12-18
Structure title title	CATALYTIC ANTIBODY D2.3 COMPLEX
Keywords keywords	ABZYME, TRANSITION STATE ANALOG, IMMUNE SYSTEM; IMMUNE SYSTEM
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	26.02 Å
Radius of gyration Rg (electron density) rg_electron	24.91 Å
Forward intensity I(0) i0	41247400.00
Molecular weight molecular_weight	48985.0 kDa
Excluded volume excluded_volume	60811 Å³
Envelope volume envelope_volume	74792 Å³
Hydration-shell volume shell_volume	25323 Å³
Envelope diameter envelope_diameter	87.5 Å
Shell Rg shell_rg	31.79 Å
Envelope Rg envelope_rg	24.54 Å
Shape Rg shape_rg	24.79 Å
Total Rg total_rg	26.01 Å
Total atoms total_atoms	3420
Residues n_residues	426
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	83.2 Å
Rg (real space) rg_real	26.02 Å
Rg uncertainty (real space) rg_real_error	0.56 Å
I(0) (real space) i0_real	4.1250e+07
I(0) uncertainty (real space) i0_real_error	5.4860e+05
Rg (reciprocal space) rg_reciprocal	26.02 Å
I(0) (reciprocal space) i0_reciprocal	41250000.0000
Solution quality estimate total_estimate	0.9068
Solution quality rating solution_quality	EXCELLENT a EXCELLENT solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	28.6 Å
Skewness Skewness skewness	0.297
Kurtosis Kurtosis kurtosis	-0.497
Angular range angular_range	— – 0.3050 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	7846000.0000
Real-space data points n_real_points	62
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.941; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.981; Smooth: 0.980

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	IG ANTIBODY D2.3 (LIGHT CHAIN)
Molecular weight formula_weight	24019.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L
Atom count atom_count	3570

DIVMTQSPLTLSVTIGQPASISCKSSQSLLYSNGKTYLNWLLQRPGQSPKRLIHLVSKLDSGVPDRITGSGSGTDFTLKISRVEAADLGVYYCVQGTHFPYTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Entity 2 Entity 2 polymer

Description description	IG ANTIBODY D2.3 (HEAVY CHAIN)
Molecular weight formula_weight	24189.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

EMQLQQSGAELLRPGTSVKLSCKTSGYIFTSYWIHWVKQRSGQGLEWIARIYPGTGSTYYNEKFKGKATLTADKSSSTAYMQLSTLKSEDSAVYFCTRWGFIPVREDYVMDYWGQGTLVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP

Entity 3 Entity 3 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	7

Entity 4 Entity 4 non-polymer

Description description	PARA-NITROPHENYL PHOSPHONOBUTANOYL L-ALANINE
Molecular weight formula_weight	360.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	150

▼

7. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d1kn2h1
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.1 — Immunoglobulin
Family Family family	b.1.1.1 — V set domains (antibody variable domain-like)

Domain ID domain_id	d1kn2h2
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.1 — Immunoglobulin
Family Family family	b.1.1.2 — C1 set domains (antibody constant domain-like)

Domain ID domain_id	d1kn2l1
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.1 — Immunoglobulin
Family Family family	b.1.1.1 — V set domains (antibody variable domain-like)

Domain ID domain_id	d1kn2l2
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.1 — Immunoglobulin
Family Family family	b.1.1.2 — C1 set domains (antibody constant domain-like)

CATH v4.4 (4 domains)

Domain ID domain_id	1kn2H01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	1kn2H02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	1kn2L01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	1kn2L02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

▶

8. Citations (1)

▶

Unit-cell length a length_a	78.275 Å
Unit-cell length b length_b	78.275 Å
Unit-cell length c length_c	158.952 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	6

Space group space_group	P 31 2 1
Space-group number int_tables_number	152
Crystal system crystal_system	—

Resolution resolution	1.900 Å
Low-resolution limit resolution_low	20.000 Å
R factor r_factor	—
R_work r_work	0.2130
R_free r_free	0.2380

fit	/app/data/saxs_computation/kn/1kn2/1kn2.fit
pddf	/app/data/pr_computation/kn/1kn2/1kn2.pr.out
profile	/app/data/saxs_computation/kn/1kn2/1kn2.dat

CATALYTIC ANTIBODY D2.3 COMPLEX

1. Protein Identity and Related Structures Protein Identity & Related Structures

IG ANTIBODY D2.3 (LIGHT CHAIN)

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)