SAXSdb — 1l0s

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

thermal hysteresis protein

Choristoneura fumiferana

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein monomer	Monomer	Protein 1	water × 1	Consistent with protein count
2	Protein monomer	Monomer	Protein 1	water × 1	Consistent with protein count
3	Protein monomer	Monomer	Protein 1	water × 1	Consistent with protein count
4	Protein monomer	Monomer	Protein 1	CADMIUM ION × 2 water × 1	Consistent with protein count
5	Protein homooligomer	Homooligomer	Protein 4	CADMIUM ION × 2 water × 4	Consistent with protein count
6	Protein homooligomer	Homooligomer	Protein 4	CADMIUM ION × 2 water × 4	Consistent with protein count
7	Protein homooligomer	Homooligomer	Protein 2	CADMIUM ION × 2 water × 2	Consistent with protein count
8	Protein homooligomer	Homooligomer	Protein 2	water × 2	Consistent with protein count
9	Protein homooligomer	Homooligomer	Protein 2	CADMIUM ION × 2 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9GTP0_CHOFU
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–90； UniProt 19–108 Author chain B； PDBConstruct 1–90； UniProt 19–108 Author chain C； PDBConstruct 1–90； UniProt 19–108 Author chain D； PDBConstruct 1–90； UniProt 19–108

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1l0s
Deposition date deposition_date	2002-02-12
Structure title title	Choristoneura fumiferana (spruce budworm) antifreeze protein isoform 337
Keywords keywords	left-handed beta-helix, antifreeze protein, iodination; ANTIFREEZE PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1l0s__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1l0s__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1l0s__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	12.36 Å
Rg (electron density)	11.30 Å
Total Rg	12.57 Å
Atom count	615
Residues	87
Excluded volume	10836 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1l0s__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`1l0s__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`1l0s__assembly_3__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`1l0s__assembly_4__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	1	`1l0s__assembly_5__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
6	1	`1l0s__assembly_6__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
7	1	`1l0s__assembly_7__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
8	1	`1l0s__assembly_8__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
9	1	`1l0s__assembly_9__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	thermal hysteresis protein
Molecular weight formula_weight	9303.8 kDa
Mutation mutation	Y33F
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	2643

DGSCTNTNSQLSANSKCEKSTLTNCYVDKSEVFGTTCTGSRFDGVTITTSTSTGSRISGPGCKISTCIITGGVPAPSAACKISGCTFSAN

Source Source

Source organism organism	Choristoneura fumiferana
Common name common_name	spruce budworm
NCBI taxonomy ID ncbi_taxonomy_id	7141
Host organism host_organism	Escherichia coli BL21

Entity 2 Entity 2 non-polymer

Description description	CADMIUM ION
Molecular weight formula_weight	112.4 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	181

▼

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d1l0sa_
Class class	b — All beta proteins
Fold Fold fold	b.81 — Single-stranded left-handed beta-helix
Superfamily Superfamily superfamily	b.81.2 — An insect antifreeze protein
Family Family family	b.81.2.1 — An insect antifreeze protein

Domain ID domain_id	d1l0sb_
Class class	b — All beta proteins
Fold Fold fold	b.81 — Single-stranded left-handed beta-helix
Superfamily Superfamily superfamily	b.81.2 — An insect antifreeze protein
Family Family family	b.81.2.1 — An insect antifreeze protein

Domain ID domain_id	d1l0sc_
Class class	b — All beta proteins
Fold Fold fold	b.81 — Single-stranded left-handed beta-helix
Superfamily Superfamily superfamily	b.81.2 — An insect antifreeze protein
Family Family family	b.81.2.1 — An insect antifreeze protein

Domain ID domain_id	d1l0sd_
Class class	b — All beta proteins
Fold Fold fold	b.81 — Single-stranded left-handed beta-helix
Superfamily Superfamily superfamily	b.81.2 — An insect antifreeze protein
Family Family family	b.81.2.1 — An insect antifreeze protein

CATH v4.4 (4 domains)

Domain ID domain_id	1l0sA00
Class class	2 — Mainly Beta
Architecture architecture	160 — 3 Solenoid
Topology topology	10 — UDP N-Acetylglucosamine Acyltransferase; domain 1
Homologous superfamily homologous superfamily	20 — Insect antifreeze protein

Domain ID domain_id	1l0sB00
Class class	2 — Mainly Beta
Architecture architecture	160 — 3 Solenoid
Topology topology	10 — UDP N-Acetylglucosamine Acyltransferase; domain 1
Homologous superfamily homologous superfamily	20 — Insect antifreeze protein

Domain ID domain_id	1l0sC00
Class class	2 — Mainly Beta
Architecture architecture	160 — 3 Solenoid
Topology topology	10 — UDP N-Acetylglucosamine Acyltransferase; domain 1
Homologous superfamily homologous superfamily	20 — Insect antifreeze protein

Domain ID domain_id	1l0sD00
Class class	2 — Mainly Beta
Architecture architecture	160 — 3 Solenoid
Topology topology	10 — UDP N-Acetylglucosamine Acyltransferase; domain 1
Homologous superfamily homologous superfamily	20 — Insect antifreeze protein

▶

Unit-cell length a length_a	128.400 Å
Unit-cell length b length_b	128.400 Å
Unit-cell length c length_c	68.320 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	24

Space group space_group	P 65
Space-group number int_tables_number	170
Crystal system crystal_system	—

Resolution resolution	2.300 Å
Low-resolution limit resolution_low	46.790 Å
R factor r_factor	0.2270
R_work r_work	0.2230
R_free r_free	0.2640

Choristoneura fumiferana (spruce budworm) antifreeze protein isoform 337

1. Protein Identity and Related Structures Protein Identity & Related Structures

thermal hysteresis protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1l0s__assembly_1__model_1

1l0s__assembly_1__model_1 | I(q)

1l0s__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)

Choristoneura fumiferana (spruce budworm) antifreeze protein isoform 337

1. Protein Identity and Related Structures Protein Identity & Related Structures

thermal hysteresis protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1l0s__assembly_1__model_1

1l0s__assembly_1__model_1 | I(q)

1l0s__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)