1m5h

Formylmethanofuran:tetrahydromethanopterin formyltransferase from Archaeoglobus fulgidus

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Formylmethanofuran--tetrahydromethanopterin formyltransferase

Archaeoglobus fulgidus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 4	POTASSIUM ION × 12 water × 4	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 4	POTASSIUM ION × 12 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FTR_ARCFU
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–297； UniProt 1–297 Author chain B； PDBConstruct 1–297； UniProt 1–297 Author chain C； PDBConstruct 1–297； UniProt 1–297 Author chain D； PDBConstruct 1–297； UniProt 1–297 Author chain E； PDBConstruct 1–297； UniProt 1–297 Author chain F； PDBConstruct 1–297； UniProt 1–297 Author chain G； PDBConstruct 1–297； UniProt 1–297 Author chain H； PDBConstruct 1–297； UniProt 1–297

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1m5h
Deposition date deposition_date	2002-07-09
Structure title title	Formylmethanofuran:tetrahydromethanopterin formyltransferase from Archaeoglobus fulgidus
Keywords keywords	ALPHA/BETA SANDWICH, transferase; TRANSFERASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1m5h__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1m5h__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1m5h__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	30.77 Å
Rg (electron density)	29.49 Å
Total Rg	30.35 Å
Atom count	8932
Residues	1188
Excluded volume	161160 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1m5h__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`1m5h__assembly_2__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Formylmethanofuran--tetrahydromethanopterin formyltransferase
Molecular weight formula_weight	31702.2 kDa
EC 编号 ec_number	2.3.1.101
Source method src_method	man
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H
Atom count atom_count	19658

MKVNGVEVEETFAEAFDIKIARVLITGYDYYWAWVAANEATGFGTSVIMCPAEAGIEIKAKPSETPDGRPGYYIQICHMSKKGLEEQLLARLGQCVLTAPTTAVFNGLPDAEEKDDTGFKLKFFADGYQKEVEVGGRKCWAVPMMEGDFIIENDIGYTNGIAGGNFFIMAETQPSALAAAKAAVDAISDVEGVITPFPGGIVASGSKVGANKYKFLKASTNEKFAPSIRDQVEGTQIPAGVKAVYEIVINGLNADAIKEATRVGILAATKIPGVVKITAGNYGGKLGKHIINLNELF

Source Source

Source organism organism	Archaeoglobus fulgidus
NCBI taxonomy ID ncbi_taxonomy_id	2234
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 non-polymer

Description description	POTASSIUM ION
Molecular weight formula_weight	39.1 kDa
Source method src_method	syn
Copy count entity_count	24

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	1794

▼

6. Fold Classification (SCOP + CATH) 32 domains

SCOP 2.08 (16 domains)

Domain ID domain_id	d1m5ha1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.33 — Formylmethanofuran:tetrahydromethanopterin formyltransferase
Family Family family	d.58.33.1 — Formylmethanofuran:tetrahydromethanopterin formyltransferase

Domain ID domain_id	d1m5ha2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.33 — Formylmethanofuran:tetrahydromethanopterin formyltransferase
Family Family family	d.58.33.1 — Formylmethanofuran:tetrahydromethanopterin formyltransferase

Domain ID domain_id	d1m5hb1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.33 — Formylmethanofuran:tetrahydromethanopterin formyltransferase
Family Family family	d.58.33.1 — Formylmethanofuran:tetrahydromethanopterin formyltransferase

Domain ID domain_id	d1m5hb2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.33 — Formylmethanofuran:tetrahydromethanopterin formyltransferase
Family Family family	d.58.33.1 — Formylmethanofuran:tetrahydromethanopterin formyltransferase

Domain ID domain_id	d1m5hc1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.33 — Formylmethanofuran:tetrahydromethanopterin formyltransferase
Family Family family	d.58.33.1 — Formylmethanofuran:tetrahydromethanopterin formyltransferase

Domain ID domain_id	d1m5hc2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.33 — Formylmethanofuran:tetrahydromethanopterin formyltransferase
Family Family family	d.58.33.1 — Formylmethanofuran:tetrahydromethanopterin formyltransferase

Domain ID domain_id	d1m5hd1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.33 — Formylmethanofuran:tetrahydromethanopterin formyltransferase
Family Family family	d.58.33.1 — Formylmethanofuran:tetrahydromethanopterin formyltransferase

Domain ID domain_id	d1m5hd2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.33 — Formylmethanofuran:tetrahydromethanopterin formyltransferase
Family Family family	d.58.33.1 — Formylmethanofuran:tetrahydromethanopterin formyltransferase

Domain ID domain_id	d1m5he1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.33 — Formylmethanofuran:tetrahydromethanopterin formyltransferase
Family Family family	d.58.33.1 — Formylmethanofuran:tetrahydromethanopterin formyltransferase

Domain ID domain_id	d1m5he2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.33 — Formylmethanofuran:tetrahydromethanopterin formyltransferase
Family Family family	d.58.33.1 — Formylmethanofuran:tetrahydromethanopterin formyltransferase

Domain ID domain_id	d1m5hf1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.33 — Formylmethanofuran:tetrahydromethanopterin formyltransferase
Family Family family	d.58.33.1 — Formylmethanofuran:tetrahydromethanopterin formyltransferase

Domain ID domain_id	d1m5hf2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.33 — Formylmethanofuran:tetrahydromethanopterin formyltransferase
Family Family family	d.58.33.1 — Formylmethanofuran:tetrahydromethanopterin formyltransferase

Domain ID domain_id	d1m5hg1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.33 — Formylmethanofuran:tetrahydromethanopterin formyltransferase
Family Family family	d.58.33.1 — Formylmethanofuran:tetrahydromethanopterin formyltransferase

Domain ID domain_id	d1m5hg2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.33 — Formylmethanofuran:tetrahydromethanopterin formyltransferase
Family Family family	d.58.33.1 — Formylmethanofuran:tetrahydromethanopterin formyltransferase

Domain ID domain_id	d1m5hh1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.33 — Formylmethanofuran:tetrahydromethanopterin formyltransferase
Family Family family	d.58.33.1 — Formylmethanofuran:tetrahydromethanopterin formyltransferase

Domain ID domain_id	d1m5hh2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.33 — Formylmethanofuran:tetrahydromethanopterin formyltransferase
Family Family family	d.58.33.1 — Formylmethanofuran:tetrahydromethanopterin formyltransferase

CATH v4.4 (16 domains)

Domain ID domain_id	1m5hA01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	520 —

Domain ID domain_id	1m5hA02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	520 —

Domain ID domain_id	1m5hB01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	520 —

Domain ID domain_id	1m5hB02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	520 —

Domain ID domain_id	1m5hC01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	520 —

Domain ID domain_id	1m5hC02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	520 —

Domain ID domain_id	1m5hD01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	520 —

Domain ID domain_id	1m5hD02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	520 —

Domain ID domain_id	1m5hE01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	520 —

Domain ID domain_id	1m5hE02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	520 —

Domain ID domain_id	1m5hF01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	520 —

Domain ID domain_id	1m5hF02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	520 —

Domain ID domain_id	1m5hG01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	520 —

Domain ID domain_id	1m5hG02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	520 —

Domain ID domain_id	1m5hH01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	520 —

Domain ID domain_id	1m5hH02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	520 —

▶

Unit-cell length a length_a	77.100 Å
Unit-cell length b length_b	81.810 Å
Unit-cell length c length_c	99.100 Å
Unit-cell angle α angle_alpha	90.10 °
Unit-cell angle β angle_beta	110.04 °
Unit-cell angle γ angle_gamma	93.75 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.000 Å
Low-resolution limit resolution_low	29.250 Å
R factor r_factor	0.2290
R_work r_work	0.2290
R_free r_free	0.2820

Formylmethanofuran:tetrahydromethanopterin formyltransferase from Archaeoglobus fulgidus

1. Protein Identity and Related Structures Protein Identity & Related Structures

Formylmethanofuran--tetrahydromethanopterin formyltransferase

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1m5h__assembly_1__model_1

1m5h__assembly_1__model_1 | I(q)

1m5h__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 32 domains

SCOP 2.08 (16 domains)

CATH v4.4 (16 domains)

7. Citations (1)

Formylmethanofuran:tetrahydromethanopterin formyltransferase from Archaeoglobus fulgidus

1. Protein Identity and Related Structures Protein Identity & Related Structures

Formylmethanofuran--tetrahydromethanopterin formyltransferase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1m5h__assembly_1__model_1

1m5h__assembly_1__model_1 | I(q)

1m5h__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 32 domains

SCOP 2.08 (16 domains)

CATH v4.4 (16 domains)

7. Citations (1)