1nc7

Crystal Structure of Thermotoga maritima 1070

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

hypothetical protein TM1070

Thermotoga maritima

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 4	CHLORIDE ION × 2 MAGNESIUM ION × 4 1,2-ETHANEDIOL × 3 FORMIC ACID × 4 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9X0F9_THEMA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 23–136； UniProt 1–114 Author chain B； PDBConstruct 23–136； UniProt 1–114 Author chain C； PDBConstruct 23–136； UniProt 1–114 Author chain D； PDBConstruct 23–136； UniProt 1–114

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1nc7
Deposition date deposition_date	2002-12-04
Structure title title	Crystal Structure of Thermotoga maritima 1070
Keywords keywords	;Structural genomics, Hypothetical protein, Molecular propeller, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION ;; STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1nc7__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1nc7__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1nc7__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	21.68 Å
Rg (electron density)	20.66 Å
Total Rg	21.56 Å
Atom count	3747
Residues	441
Excluded volume	67642 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1nc7__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	hypothetical protein TM1070
Molecular weight formula_weight	16121.3 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	4302

MGSSHHHHHHSSGRENLYFQGHMNGARKWFFPDGYIPNGKRGYLVSHESLCIMNTGDETAKIRITFLFEDSKPVVHEVEISPMKSLHLRLDKLGIPKCKPYSIMAESNVPVVMQLSRLDVGKNHYTLMTTIGYWEEGS

Source Source

Source organism organism	Thermotoga maritima
NCBI taxonomy ID ncbi_taxonomy_id	2336
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 3 Entity 3 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 4 Entity 4 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 5 Entity 5 non-polymer

Description description	FORMIC ACID
Molecular weight formula_weight	46.0 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	526

▼

6. Fold Classification (SCOP + CATH) 14 domains

SCOP 2.08 (10 domains)

Domain ID domain_id	d1nc7a1
Class class	b — All beta proteins
Fold Fold fold	b.123 — Hypothetical protein TM1070
Superfamily Superfamily superfamily	b.123.1 — Hypothetical protein TM1070
Family Family family	b.123.1.1 — Hypothetical protein TM1070

Domain ID domain_id	d1nc7a2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d1nc7a3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d1nc7b1
Class class	b — All beta proteins
Fold Fold fold	b.123 — Hypothetical protein TM1070
Superfamily Superfamily superfamily	b.123.1 — Hypothetical protein TM1070
Family Family family	b.123.1.1 — Hypothetical protein TM1070

Domain ID domain_id	d1nc7b2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d1nc7c1
Class class	b — All beta proteins
Fold Fold fold	b.123 — Hypothetical protein TM1070
Superfamily Superfamily superfamily	b.123.1 — Hypothetical protein TM1070
Family Family family	b.123.1.1 — Hypothetical protein TM1070

Domain ID domain_id	d1nc7c2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d1nc7d1
Class class	b — All beta proteins
Fold Fold fold	b.123 — Hypothetical protein TM1070
Superfamily Superfamily superfamily	b.123.1 — Hypothetical protein TM1070
Family Family family	b.123.1.1 — Hypothetical protein TM1070

Domain ID domain_id	d1nc7d2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d1nc7d3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

CATH v4.4 (4 domains)

Domain ID domain_id	1nc7A00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	290 — Hypothetical Protein Tm1070; Chain: A
Homologous superfamily homologous superfamily	11 — TM1070-like

Domain ID domain_id	1nc7B00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	290 — Hypothetical Protein Tm1070; Chain: A
Homologous superfamily homologous superfamily	11 — TM1070-like

Domain ID domain_id	1nc7C00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	290 — Hypothetical Protein Tm1070; Chain: A
Homologous superfamily homologous superfamily	11 — TM1070-like

Domain ID domain_id	1nc7D00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	290 — Hypothetical Protein Tm1070; Chain: A
Homologous superfamily homologous superfamily	11 — TM1070-like

▶

Unit-cell length a length_a	54.435 Å
Unit-cell length b length_b	54.453 Å
Unit-cell length c length_c	55.178 Å
Unit-cell angle α angle_alpha	63.18 °
Unit-cell angle β angle_beta	62.27 °
Unit-cell angle γ angle_gamma	89.81 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	1.550 Å
Low-resolution limit resolution_low	29.400 Å
R factor r_factor	0.1710
R_work r_work	0.1696
R_free r_free	0.1900

Crystal Structure of Thermotoga maritima 1070

1. Protein Identity and Related Structures Protein Identity & Related Structures

hypothetical protein TM1070

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1nc7__assembly_1__model_1

1nc7__assembly_1__model_1 | I(q)

1nc7__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

6. Fold Classification (SCOP + CATH) 14 domains

SCOP 2.08 (10 domains)

CATH v4.4 (4 domains)

7. Citations (1)

Crystal Structure of Thermotoga maritima 1070

1. Protein Identity and Related Structures Protein Identity & Related Structures

hypothetical protein TM1070

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1nc7__assembly_1__model_1

1nc7__assembly_1__model_1 | I(q)

1nc7__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

6. Fold Classification (SCOP + CATH) 14 domains

SCOP 2.08 (10 domains)

CATH v4.4 (4 domains)

7. Citations (1)