1nlx

Crystal Structure of PHL P 6, A Major Timothy Grass Pollen Allergen Co-Crystallized with Zinc

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Pollen allergen Phl p 6

Phleum pratense

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 14	ZINC ION × 28 ARSENIC × 7	Consistent with protein count
10	Protein homooligomer	Homooligomer	Protein 2	ZINC ION × 4 ARSENIC × 2	Consistent with protein count
11	Protein homooligomer	Homooligomer	Protein 2	ZINC ION × 4	Consistent with protein count
12	Protein homooligomer	Homooligomer	Protein 2	ZINC ION × 4 ARSENIC × 1	Consistent with protein count
13	Protein homooligomer	Homooligomer	Protein 2	ZINC ION × 4	Consistent with protein count
14	Protein homooligomer	Homooligomer	Protein 2	ZINC ION × 4 ARSENIC × 1	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 2	ZINC ION × 4 ARSENIC × 1	Consistent with protein count
3	Protein homooligomer	Homooligomer	Protein 2	ZINC ION × 4 ARSENIC × 1	Consistent with protein count
4	Protein homooligomer	Homooligomer	Protein 2	ZINC ION × 4 ARSENIC × 1	Consistent with protein count
5	Protein homooligomer	Homooligomer	Protein 2	ZINC ION × 4 ARSENIC × 1	Consistent with protein count
6	Protein homooligomer	Homooligomer	Protein 2	ZINC ION × 4 ARSENIC × 1	Consistent with protein count
7	Protein homooligomer	Homooligomer	Protein 2	ZINC ION × 4 ARSENIC × 1	Consistent with protein count
8	Protein homooligomer	Homooligomer	Protein 2	ZINC ION × 4 ARSENIC × 1	Consistent with protein count
9	Protein homooligomer	Homooligomer	Protein 2	ZINC ION × 4 ARSENIC × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MPAP6_PHLPR
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–111； UniProt 23–132 Author chain B； PDBConstruct 2–111； UniProt 23–132 Author chain C； PDBConstruct 2–111； UniProt 23–132 Author chain D； PDBConstruct 2–111； UniProt 23–132 Author chain E； PDBConstruct 2–111； UniProt 23–132 Author chain F； PDBConstruct 2–111； UniProt 23–132 Author chain G； PDBConstruct 2–111； UniProt 23–132 Author chain H； PDBConstruct 2–111； UniProt 23–132 Author chain I； PDBConstruct 2–111； UniProt 23–132 Author chain J； PDBConstruct 2–111； UniProt 23–132 Author chain K； PDBConstruct 2–111； UniProt 23–132 Author chain L； PDBConstruct 2–111； UniProt 23–132 Author chain M； PDBConstruct 2–111； UniProt 23–132 Author chain N； PDBConstruct 2–111； UniProt 23–132

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1nlx
Deposition date deposition_date	2003-01-07
Structure title title	Crystal Structure of PHL P 6, A Major Timothy Grass Pollen Allergen Co-Crystallized with Zinc
Keywords keywords	;Allergen Phl p 6, four-helix-bundle, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, ALLERGEN ;; ALLERGEN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1nlx__assembly_3__model_1

Assembly 3 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1nlx__assembly_3__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1nlx__assembly_3__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	18.75 Å
Rg (electron density)	18.08 Å
Total Rg	18.93 Å
Atom count	1593
Residues	208
Excluded volume	28284 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1nlx__assembly_1__model_1`	tetradecameric （14）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`1nlx__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`1nlx__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`1nlx__assembly_4__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	1	`1nlx__assembly_5__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
6	1	`1nlx__assembly_6__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
7	1	`1nlx__assembly_7__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
8	1	`1nlx__assembly_8__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
9	1	`1nlx__assembly_9__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
10	1	`1nlx__assembly_10__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
11	1	`1nlx__assembly_11__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
12	1	`1nlx__assembly_12__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
13	1	`1nlx__assembly_13__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
14	1	`1nlx__assembly_14__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Pollen allergen Phl p 6
Molecular weight formula_weight	11936.4 kDa
Source method src_method	man
Copy count entity_count	14

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H,I,J,K,L,M,N
Atom count atom_count	11151

MGKATTEEQKLIEDVNASFRAAMATTANVPPADKYKTFEAAFTVSSKRNLADAVSKAPQLVPKLDEVYNAAYNAADHAAPEDKYEAFVLHFSEALRIIAGTPEVHAVKPGA

Source Source

Source organism organism	Phleum pratense
Common name common_name	timothy grass
NCBI taxonomy ID ncbi_taxonomy_id	15957
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	28

Entity 3 Entity 3 non-polymer

Description description	ARSENIC
Molecular weight formula_weight	74.9 kDa
Source method src_method	syn
Copy count entity_count	7

▼

6. Fold Classification (SCOP + CATH) 28 domains

SCOP 2.08 (14 domains)

Domain ID domain_id	d1nlxa_
Class class	a — All alpha proteins
Fold Fold fold	a.24 — Four-helical up-and-down bundle
Superfamily Superfamily superfamily	a.24.17 — Group V grass pollen allergen
Family Family family	a.24.17.1 — Group V grass pollen allergen

Domain ID domain_id	d1nlxb_
Class class	a — All alpha proteins
Fold Fold fold	a.24 — Four-helical up-and-down bundle
Superfamily Superfamily superfamily	a.24.17 — Group V grass pollen allergen
Family Family family	a.24.17.1 — Group V grass pollen allergen

Domain ID domain_id	d1nlxc_
Class class	a — All alpha proteins
Fold Fold fold	a.24 — Four-helical up-and-down bundle
Superfamily Superfamily superfamily	a.24.17 — Group V grass pollen allergen
Family Family family	a.24.17.1 — Group V grass pollen allergen

Domain ID domain_id	d1nlxd_
Class class	a — All alpha proteins
Fold Fold fold	a.24 — Four-helical up-and-down bundle
Superfamily Superfamily superfamily	a.24.17 — Group V grass pollen allergen
Family Family family	a.24.17.1 — Group V grass pollen allergen

Domain ID domain_id	d1nlxe_
Class class	a — All alpha proteins
Fold Fold fold	a.24 — Four-helical up-and-down bundle
Superfamily Superfamily superfamily	a.24.17 — Group V grass pollen allergen
Family Family family	a.24.17.1 — Group V grass pollen allergen

Domain ID domain_id	d1nlxf_
Class class	a — All alpha proteins
Fold Fold fold	a.24 — Four-helical up-and-down bundle
Superfamily Superfamily superfamily	a.24.17 — Group V grass pollen allergen
Family Family family	a.24.17.1 — Group V grass pollen allergen

Domain ID domain_id	d1nlxg_
Class class	a — All alpha proteins
Fold Fold fold	a.24 — Four-helical up-and-down bundle
Superfamily Superfamily superfamily	a.24.17 — Group V grass pollen allergen
Family Family family	a.24.17.1 — Group V grass pollen allergen

Domain ID domain_id	d1nlxh_
Class class	a — All alpha proteins
Fold Fold fold	a.24 — Four-helical up-and-down bundle
Superfamily Superfamily superfamily	a.24.17 — Group V grass pollen allergen
Family Family family	a.24.17.1 — Group V grass pollen allergen

Domain ID domain_id	d1nlxi_
Class class	a — All alpha proteins
Fold Fold fold	a.24 — Four-helical up-and-down bundle
Superfamily Superfamily superfamily	a.24.17 — Group V grass pollen allergen
Family Family family	a.24.17.1 — Group V grass pollen allergen

Domain ID domain_id	d1nlxj_
Class class	a — All alpha proteins
Fold Fold fold	a.24 — Four-helical up-and-down bundle
Superfamily Superfamily superfamily	a.24.17 — Group V grass pollen allergen
Family Family family	a.24.17.1 — Group V grass pollen allergen

Domain ID domain_id	d1nlxk_
Class class	a — All alpha proteins
Fold Fold fold	a.24 — Four-helical up-and-down bundle
Superfamily Superfamily superfamily	a.24.17 — Group V grass pollen allergen
Family Family family	a.24.17.1 — Group V grass pollen allergen

Domain ID domain_id	d1nlxl_
Class class	a — All alpha proteins
Fold Fold fold	a.24 — Four-helical up-and-down bundle
Superfamily Superfamily superfamily	a.24.17 — Group V grass pollen allergen
Family Family family	a.24.17.1 — Group V grass pollen allergen

Domain ID domain_id	d1nlxm_
Class class	a — All alpha proteins
Fold Fold fold	a.24 — Four-helical up-and-down bundle
Superfamily Superfamily superfamily	a.24.17 — Group V grass pollen allergen
Family Family family	a.24.17.1 — Group V grass pollen allergen

Domain ID domain_id	d1nlxn_
Class class	a — All alpha proteins
Fold Fold fold	a.24 — Four-helical up-and-down bundle
Superfamily Superfamily superfamily	a.24.17 — Group V grass pollen allergen
Family Family family	a.24.17.1 — Group V grass pollen allergen

CATH v4.4 (14 domains)

Domain ID domain_id	1nlxA00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	320 — Group V grass pollen allergen

Domain ID domain_id	1nlxB00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	320 — Group V grass pollen allergen

Domain ID domain_id	1nlxC00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	320 — Group V grass pollen allergen

Domain ID domain_id	1nlxD00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	320 — Group V grass pollen allergen

Domain ID domain_id	1nlxE00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	320 — Group V grass pollen allergen

Domain ID domain_id	1nlxF00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	320 — Group V grass pollen allergen

Domain ID domain_id	1nlxG00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	320 — Group V grass pollen allergen

Domain ID domain_id	1nlxH00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	320 — Group V grass pollen allergen

Domain ID domain_id	1nlxI00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	320 — Group V grass pollen allergen

Domain ID domain_id	1nlxJ00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	320 — Group V grass pollen allergen

Domain ID domain_id	1nlxK00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	320 — Group V grass pollen allergen

Domain ID domain_id	1nlxL00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	320 — Group V grass pollen allergen

Domain ID domain_id	1nlxM00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	320 — Group V grass pollen allergen

Domain ID domain_id	1nlxN00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	320 — Group V grass pollen allergen

▶

Unit-cell length a length_a	110.809 Å
Unit-cell length b length_b	110.335 Å
Unit-cell length c length_c	159.420 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	56

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.800 Å
Low-resolution limit resolution_low	20.000 Å
R factor r_factor	0.2480
R_work r_work	0.2430
R_free r_free	0.2720

Crystal Structure of PHL P 6, A Major Timothy Grass Pollen Allergen Co-Crystallized with Zinc

1. Protein Identity and Related Structures Protein Identity & Related Structures

Pollen allergen Phl p 6

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1nlx__assembly_3__model_1

1nlx__assembly_3__model_1 | I(q)

1nlx__assembly_3__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

6. Fold Classification (SCOP + CATH) 28 domains

SCOP 2.08 (14 domains)

CATH v4.4 (14 domains)

7. Citations (4)

Crystal Structure of PHL P 6, A Major Timothy Grass Pollen Allergen Co-Crystallized with Zinc

1. Protein Identity and Related Structures Protein Identity & Related Structures

Pollen allergen Phl p 6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1nlx__assembly_3__model_1

1nlx__assembly_3__model_1 | I(q)

1nlx__assembly_3__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

6. Fold Classification (SCOP + CATH) 28 domains

SCOP 2.08 (14 domains)

CATH v4.4 (14 domains)

7. Citations (4)