1npp

CRYSTAL STRUCTURE OF AQUIFEX AEOLICUS NUSG IN P2(1)

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Transcription antitermination protein nusG

Aquifex aeolicus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein monomer	Monomer	Protein 1	water × 1	Consistent with protein count
2	Protein monomer	Monomer	Protein 1	water × 1	Consistent with protein count
3	Protein monomer	Monomer	Protein 1	water × 1	Consistent with protein count
4	Protein monomer	Monomer	Protein 1	ISOPROPYL ALCOHOL × 2 water × 1	Consistent with protein count
5	Protein homooligomer	Homooligomer	Protein 2	water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NUSG_AQUAE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–248； UniProt 1–248 Author chain B； PDBConstruct 1–248； UniProt 1–248 Author chain C； PDBConstruct 1–248； UniProt 1–248 Author chain D； PDBConstruct 1–248； UniProt 1–248

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1npp
Deposition date deposition_date	2003-01-18
Structure title title	CRYSTAL STRUCTURE OF AQUIFEX AEOLICUS NUSG IN P2(1)
Keywords keywords	RNAP transcription factor, NusG, TRANSCRIPTION; TRANSCRIPTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1npp__assembly_4__model_1

Assembly 4 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1npp__assembly_4__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1npp__assembly_4__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	24.00 Å
Rg (electron density)	23.17 Å
Total Rg	24.05 Å
Atom count	1905
Residues	240
Excluded volume	34585 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1npp__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`1npp__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`1npp__assembly_3__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`1npp__assembly_4__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	1	`1npp__assembly_5__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Transcription antitermination protein nusG
Molecular weight formula_weight	28041.7 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	8486

MSEQQVQELEKKWYALQVEPGKENEAKENLLKVLELEGLKDLVDEVIVPAEEKVVIRAQGKEKYRLSLKGNARDISVLGKKGVTTFRIENGEVKVVESVEGDTCVNAPPISKPGQKITCKENKTEAKIVLDNKIFPGYILIKAHMNDKLLMAIEKTPHVFRPVMVGGKPVPLKEEEVQNILNQIKRGVKPSKVEFEKGDQVRVIEGPFMNFTGTVEEVHPEKRKLTVMISIFGRMTPVELDFDQVEKI

Source Source

Source organism organism	Aquifex aeolicus
NCBI taxonomy ID ncbi_taxonomy_id	63363
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 non-polymer

Description description	ISOPROPYL ALCOHOL
Molecular weight formula_weight	60.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	858

▼

6. Fold Classification (SCOP + CATH) 24 domains

SCOP 2.08 (12 domains)

Domain ID domain_id	d1nppa1
Class class	b — All beta proteins
Fold Fold fold	b.114 — N-utilization substance G protein NusG, insert domain
Superfamily Superfamily superfamily	b.114.1 — N-utilization substance G protein NusG, insert domain
Family Family family	b.114.1.1 — N-utilization substance G protein NusG, insert domain

Domain ID domain_id	d1nppa2
Class class	b — All beta proteins
Fold Fold fold	b.34 — SH3-like barrel
Superfamily Superfamily superfamily	b.34.5 — Translation proteins SH3-like domain
Family Family family	b.34.5.4 — N-utilization substance G protein NusG, C-terminal domain

Domain ID domain_id	d1nppa3
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.42 — N-utilization substance G protein NusG, N-terminal domain
Family Family family	d.58.42.1 — N-utilization substance G protein NusG, N-terminal domain

Domain ID domain_id	d1nppb1
Class class	b — All beta proteins
Fold Fold fold	b.114 — N-utilization substance G protein NusG, insert domain
Superfamily Superfamily superfamily	b.114.1 — N-utilization substance G protein NusG, insert domain
Family Family family	b.114.1.1 — N-utilization substance G protein NusG, insert domain

Domain ID domain_id	d1nppb2
Class class	b — All beta proteins
Fold Fold fold	b.34 — SH3-like barrel
Superfamily Superfamily superfamily	b.34.5 — Translation proteins SH3-like domain
Family Family family	b.34.5.4 — N-utilization substance G protein NusG, C-terminal domain

Domain ID domain_id	d1nppb3
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.42 — N-utilization substance G protein NusG, N-terminal domain
Family Family family	d.58.42.1 — N-utilization substance G protein NusG, N-terminal domain

Domain ID domain_id	d1nppc1
Class class	b — All beta proteins
Fold Fold fold	b.114 — N-utilization substance G protein NusG, insert domain
Superfamily Superfamily superfamily	b.114.1 — N-utilization substance G protein NusG, insert domain
Family Family family	b.114.1.1 — N-utilization substance G protein NusG, insert domain

Domain ID domain_id	d1nppc2
Class class	b — All beta proteins
Fold Fold fold	b.34 — SH3-like barrel
Superfamily Superfamily superfamily	b.34.5 — Translation proteins SH3-like domain
Family Family family	b.34.5.4 — N-utilization substance G protein NusG, C-terminal domain

Domain ID domain_id	d1nppc3
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.42 — N-utilization substance G protein NusG, N-terminal domain
Family Family family	d.58.42.1 — N-utilization substance G protein NusG, N-terminal domain

Domain ID domain_id	d1nppd1
Class class	b — All beta proteins
Fold Fold fold	b.114 — N-utilization substance G protein NusG, insert domain
Superfamily Superfamily superfamily	b.114.1 — N-utilization substance G protein NusG, insert domain
Family Family family	b.114.1.1 — N-utilization substance G protein NusG, insert domain

Domain ID domain_id	d1nppd2
Class class	b — All beta proteins
Fold Fold fold	b.34 — SH3-like barrel
Superfamily Superfamily superfamily	b.34.5 — Translation proteins SH3-like domain
Family Family family	b.34.5.4 — N-utilization substance G protein NusG, C-terminal domain

Domain ID domain_id	d1nppd3
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.42 — N-utilization substance G protein NusG, N-terminal domain
Family Family family	d.58.42.1 — N-utilization substance G protein NusG, N-terminal domain

CATH v4.4 (12 domains)

Domain ID domain_id	1nppA01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	940 — NusG, N-terminal domain

Domain ID domain_id	1nppA02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	320 — mini-chromosome maintenance (MCM) complex, domain 2
Homologous superfamily homologous superfamily	10 — N-utilization substance G protein NusG, insert domain

Domain ID domain_id	1nppA03
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	30 —

Domain ID domain_id	1nppB01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	940 — NusG, N-terminal domain

Domain ID domain_id	1nppB02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	320 — mini-chromosome maintenance (MCM) complex, domain 2
Homologous superfamily homologous superfamily	10 — N-utilization substance G protein NusG, insert domain

Domain ID domain_id	1nppB03
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	30 —

Domain ID domain_id	1nppC01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	940 — NusG, N-terminal domain

Domain ID domain_id	1nppC02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	320 — mini-chromosome maintenance (MCM) complex, domain 2
Homologous superfamily homologous superfamily	10 — N-utilization substance G protein NusG, insert domain

Domain ID domain_id	1nppC03
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	30 —

Domain ID domain_id	1nppD01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	940 — NusG, N-terminal domain

Domain ID domain_id	1nppD02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	320 — mini-chromosome maintenance (MCM) complex, domain 2
Homologous superfamily homologous superfamily	10 — N-utilization substance G protein NusG, insert domain

Domain ID domain_id	1nppD03
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	30 —

▶

Unit-cell length a length_a	87.070 Å
Unit-cell length b length_b	55.860 Å
Unit-cell length c length_c	112.610 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.39 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	2.000 Å
Low-resolution limit resolution_low	19.980 Å
R factor r_factor	0.2590
R_work r_work	0.2190
R_free r_free	0.2790

CRYSTAL STRUCTURE OF AQUIFEX AEOLICUS NUSG IN P2(1)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Transcription antitermination protein nusG

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1npp__assembly_4__model_1

1npp__assembly_4__model_1 | I(q)

1npp__assembly_4__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 24 domains

SCOP 2.08 (12 domains)

CATH v4.4 (12 domains)

7. Citations (2)

CRYSTAL STRUCTURE OF AQUIFEX AEOLICUS NUSG IN P2(1)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Transcription antitermination protein nusG

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1npp__assembly_4__model_1

1npp__assembly_4__model_1 | I(q)

1npp__assembly_4__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 24 domains

SCOP 2.08 (12 domains)

CATH v4.4 (12 domains)

7. Citations (2)